Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N2B9

Protein Details
Accession G4N2B9   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-58IRKDRLPKRKRLLTRIKPSTCBasic
NLS Segment(s)
PositionSequence
41-48DRLPKRKR
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
KEGG mgr:MGG_16818  -  
Amino Acid Sequences MLEIFEIERDQYSVDIQGLIPRDFSYEHRIVPSFSTEIRKDRLPKRKRLLTRIKPSTCLLVDFLTTVAMATSTANEIPTVLEARN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.12
5 0.15
6 0.14
7 0.14
8 0.13
9 0.13
10 0.14
11 0.17
12 0.21
13 0.2
14 0.21
15 0.23
16 0.23
17 0.23
18 0.22
19 0.22
20 0.15
21 0.15
22 0.2
23 0.19
24 0.21
25 0.23
26 0.26
27 0.31
28 0.38
29 0.47
30 0.49
31 0.57
32 0.63
33 0.69
34 0.72
35 0.75
36 0.78
37 0.78
38 0.81
39 0.82
40 0.75
41 0.7
42 0.64
43 0.59
44 0.48
45 0.39
46 0.3
47 0.2
48 0.18
49 0.15
50 0.14
51 0.09
52 0.08
53 0.07
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.11