Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MX29

Protein Details
Accession G4MX29    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-102ESEKQNRKREELRARAKKLRSSBasic
NLS Segment(s)
PositionSequence
87-100RKREELRARAKKLR
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020850  GED_dom  
KEGG mgr:MGG_15796  -  
PROSITE View protein in PROSITE  
PS51388  GED  
Amino Acid Sequences MDIEKFLEAMKRKVNVDMDDQACAEAMAGLEAYYKVAMKTFVDNVCRQVVERHIIAPLPEIFSPVTVSRFTDDELLQIGSESEKQNRKREELRARAKKLRSSLENLQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.4
4 0.43
5 0.38
6 0.35
7 0.34
8 0.28
9 0.23
10 0.2
11 0.14
12 0.07
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.1
27 0.13
28 0.16
29 0.19
30 0.2
31 0.22
32 0.22
33 0.21
34 0.19
35 0.17
36 0.17
37 0.16
38 0.16
39 0.14
40 0.13
41 0.13
42 0.13
43 0.13
44 0.1
45 0.09
46 0.09
47 0.1
48 0.09
49 0.09
50 0.11
51 0.1
52 0.11
53 0.09
54 0.1
55 0.11
56 0.11
57 0.12
58 0.13
59 0.12
60 0.11
61 0.12
62 0.12
63 0.1
64 0.09
65 0.09
66 0.07
67 0.1
68 0.12
69 0.17
70 0.25
71 0.31
72 0.4
73 0.44
74 0.5
75 0.54
76 0.63
77 0.67
78 0.7
79 0.75
80 0.77
81 0.8
82 0.82
83 0.82
84 0.78
85 0.75
86 0.73
87 0.68
88 0.65
89 0.67