Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N2V7

Protein Details
Accession G4N2V7    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-95LEERRRPRPLKLVRKPQFEPBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 4
Family & Domain DBs
KEGG mgr:MGG_16976  -  
Amino Acid Sequences MPRRAENAQSAIPESKAMFGSWPAGPPDTDDSHQKGRFDQSKVAIRARCSINWFLACKDLSVTEIHHLVSCAMLPLEERRRPRPLKLVRKPQFEPVVMAWLGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.17
4 0.15
5 0.13
6 0.12
7 0.15
8 0.14
9 0.16
10 0.15
11 0.15
12 0.15
13 0.17
14 0.2
15 0.2
16 0.21
17 0.23
18 0.26
19 0.33
20 0.36
21 0.34
22 0.31
23 0.36
24 0.4
25 0.39
26 0.38
27 0.37
28 0.43
29 0.45
30 0.48
31 0.42
32 0.37
33 0.4
34 0.38
35 0.33
36 0.29
37 0.27
38 0.25
39 0.25
40 0.24
41 0.19
42 0.2
43 0.19
44 0.15
45 0.14
46 0.11
47 0.1
48 0.1
49 0.11
50 0.09
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.07
58 0.06
59 0.05
60 0.05
61 0.06
62 0.12
63 0.2
64 0.26
65 0.31
66 0.36
67 0.45
68 0.49
69 0.54
70 0.58
71 0.61
72 0.67
73 0.73
74 0.79
75 0.78
76 0.83
77 0.8
78 0.78
79 0.75
80 0.65
81 0.59
82 0.49
83 0.46
84 0.38