Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MN91

Protein Details
Accession G4MN91   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-37APLKKSTSLFQNKIRKRRKTIFRKLEELRHydrophilic
NLS Segment(s)
PositionSequence
22-27IRKRRK
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
KEGG mgr:MGG_16025  -  
Amino Acid Sequences MLNIYNTAAPLKKSTSLFQNKIRKRRKTIFRKLEELRLCGARIYIVIEQNNKYFTYDSEKTESWPPSSKMLEKNYPLPKEYGPVTASLSQSGMAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.43
4 0.48
5 0.54
6 0.62
7 0.65
8 0.73
9 0.8
10 0.79
11 0.78
12 0.83
13 0.84
14 0.84
15 0.87
16 0.87
17 0.84
18 0.83
19 0.77
20 0.76
21 0.68
22 0.59
23 0.5
24 0.41
25 0.34
26 0.26
27 0.23
28 0.13
29 0.11
30 0.11
31 0.11
32 0.12
33 0.13
34 0.15
35 0.16
36 0.17
37 0.18
38 0.16
39 0.15
40 0.12
41 0.12
42 0.18
43 0.2
44 0.22
45 0.25
46 0.25
47 0.26
48 0.32
49 0.33
50 0.27
51 0.3
52 0.29
53 0.3
54 0.34
55 0.36
56 0.37
57 0.42
58 0.46
59 0.44
60 0.51
61 0.54
62 0.54
63 0.51
64 0.47
65 0.41
66 0.38
67 0.36
68 0.32
69 0.24
70 0.23
71 0.26
72 0.27
73 0.27
74 0.24
75 0.23