Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4N6C4

Protein Details
Accession G4N6C4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSKWRLPKIYRLRRVRAGRPACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
KEGG mgr:MGG_17163  -  
Amino Acid Sequences MSKWRLPKIYRLRRVRAGRPACSTSPKSGVVGCQQCVMAAAADAKRAIAVIVEKKSYRIYLGTYFYAPAVASLQRQAIVDWIGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.77
5 0.72
6 0.69
7 0.67
8 0.6
9 0.59
10 0.54
11 0.47
12 0.43
13 0.39
14 0.33
15 0.29
16 0.28
17 0.29
18 0.29
19 0.25
20 0.22
21 0.21
22 0.2
23 0.2
24 0.17
25 0.09
26 0.06
27 0.08
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.04
36 0.06
37 0.11
38 0.13
39 0.15
40 0.15
41 0.17
42 0.18
43 0.18
44 0.17
45 0.14
46 0.15
47 0.18
48 0.22
49 0.22
50 0.21
51 0.21
52 0.2
53 0.19
54 0.15
55 0.11
56 0.1
57 0.1
58 0.1
59 0.12
60 0.13
61 0.14
62 0.14
63 0.14
64 0.14
65 0.14