Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N503

Protein Details
Accession G4N503    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-36LLSRLLKAPKRKIKLRGPMEHydrophilic
NLS Segment(s)
PositionSequence
23-35KAPKRKIKLRGPM
Subcellular Location(s) mito 18.5, cyto_mito 10.5, plas 4, cyto 1.5
Family & Domain DBs
KEGG mgr:MGG_16878  -  
Amino Acid Sequences MSIGGRFVILHILLFQLLSRLLKAPKRKIKLRGPMEARWHGKAWTKVQSIMTMPRTFAVLRRQKNGICYLALDFAPRLWERMGFWLNGSQLYPTITRLQHSLELRFQKVLVVSCVAALSDTQVPKKIYGRSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.08
5 0.08
6 0.09
7 0.12
8 0.17
9 0.24
10 0.33
11 0.42
12 0.51
13 0.59
14 0.65
15 0.71
16 0.76
17 0.8
18 0.78
19 0.77
20 0.74
21 0.72
22 0.72
23 0.71
24 0.64
25 0.57
26 0.51
27 0.44
28 0.44
29 0.43
30 0.4
31 0.4
32 0.38
33 0.38
34 0.38
35 0.37
36 0.33
37 0.33
38 0.33
39 0.25
40 0.24
41 0.21
42 0.21
43 0.19
44 0.2
45 0.24
46 0.28
47 0.3
48 0.33
49 0.36
50 0.35
51 0.38
52 0.39
53 0.3
54 0.22
55 0.2
56 0.18
57 0.16
58 0.15
59 0.13
60 0.09
61 0.08
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.1
68 0.16
69 0.17
70 0.14
71 0.15
72 0.17
73 0.17
74 0.16
75 0.16
76 0.11
77 0.1
78 0.11
79 0.11
80 0.11
81 0.15
82 0.15
83 0.16
84 0.17
85 0.19
86 0.24
87 0.26
88 0.28
89 0.3
90 0.34
91 0.35
92 0.34
93 0.31
94 0.27
95 0.27
96 0.25
97 0.2
98 0.17
99 0.15
100 0.15
101 0.15
102 0.13
103 0.11
104 0.09
105 0.1
106 0.13
107 0.16
108 0.17
109 0.23
110 0.25
111 0.28
112 0.34
113 0.36