Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MLJ3

Protein Details
Accession G4MLJ3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
137-159EEPLALRKGKKQKKKGKSIAMDEBasic
NLS Segment(s)
PositionSequence
143-153RKGKKQKKKGK
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
KEGG mgr:MGG_15418  -  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MDTSPEQALRDSLKSLRISGDYSDMTVVCGHDTYHVHKAIMCPRSKYFEISFKADMQENRTSCVDLSDHNPDAVKLVIDFFYLTDYKPLHKIPAWGFEIKKEPTNIEFPAAAVAEADDVTTERGDPPAEPEVHNPWEEPLALRKGKKQKKKGKSIAMDEPAGPSTEDPHSEPISLAESLLDKTFLLTHCHVYALAEYLQVGDLKGLAARKFRTEAEKHWNHPDFFEAVQEVYRTSVRSDRLLRDIVVDVMKQRKELLDRFEYQDVVSQLDLSFELLMAVKTRGWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.28
5 0.28
6 0.26
7 0.29
8 0.23
9 0.22
10 0.23
11 0.19
12 0.18
13 0.17
14 0.15
15 0.11
16 0.1
17 0.1
18 0.13
19 0.15
20 0.2
21 0.26
22 0.27
23 0.27
24 0.28
25 0.34
26 0.37
27 0.43
28 0.41
29 0.38
30 0.4
31 0.47
32 0.46
33 0.46
34 0.42
35 0.43
36 0.44
37 0.45
38 0.44
39 0.39
40 0.4
41 0.39
42 0.36
43 0.33
44 0.37
45 0.32
46 0.33
47 0.32
48 0.3
49 0.26
50 0.26
51 0.21
52 0.15
53 0.19
54 0.22
55 0.22
56 0.22
57 0.22
58 0.2
59 0.2
60 0.19
61 0.14
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.09
69 0.09
70 0.09
71 0.12
72 0.12
73 0.14
74 0.17
75 0.18
76 0.19
77 0.21
78 0.26
79 0.25
80 0.32
81 0.34
82 0.34
83 0.34
84 0.33
85 0.37
86 0.33
87 0.34
88 0.27
89 0.25
90 0.24
91 0.27
92 0.25
93 0.21
94 0.19
95 0.16
96 0.16
97 0.14
98 0.11
99 0.07
100 0.07
101 0.05
102 0.05
103 0.05
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.06
112 0.06
113 0.09
114 0.13
115 0.14
116 0.15
117 0.17
118 0.2
119 0.22
120 0.22
121 0.19
122 0.15
123 0.14
124 0.14
125 0.12
126 0.11
127 0.15
128 0.17
129 0.18
130 0.24
131 0.34
132 0.42
133 0.51
134 0.58
135 0.64
136 0.71
137 0.81
138 0.84
139 0.83
140 0.82
141 0.78
142 0.75
143 0.68
144 0.59
145 0.48
146 0.4
147 0.3
148 0.24
149 0.18
150 0.1
151 0.09
152 0.09
153 0.11
154 0.11
155 0.14
156 0.14
157 0.14
158 0.14
159 0.13
160 0.14
161 0.12
162 0.11
163 0.08
164 0.08
165 0.08
166 0.09
167 0.08
168 0.06
169 0.06
170 0.08
171 0.09
172 0.13
173 0.14
174 0.16
175 0.16
176 0.16
177 0.16
178 0.14
179 0.13
180 0.11
181 0.1
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.05
189 0.05
190 0.05
191 0.06
192 0.09
193 0.1
194 0.14
195 0.16
196 0.19
197 0.21
198 0.23
199 0.3
200 0.31
201 0.36
202 0.42
203 0.48
204 0.49
205 0.56
206 0.6
207 0.52
208 0.49
209 0.45
210 0.37
211 0.3
212 0.28
213 0.19
214 0.15
215 0.15
216 0.15
217 0.12
218 0.12
219 0.13
220 0.11
221 0.13
222 0.17
223 0.19
224 0.26
225 0.31
226 0.33
227 0.37
228 0.39
229 0.37
230 0.34
231 0.33
232 0.29
233 0.25
234 0.21
235 0.21
236 0.27
237 0.27
238 0.25
239 0.25
240 0.27
241 0.32
242 0.36
243 0.39
244 0.39
245 0.42
246 0.47
247 0.48
248 0.44
249 0.38
250 0.38
251 0.31
252 0.26
253 0.22
254 0.18
255 0.15
256 0.15
257 0.15
258 0.1
259 0.1
260 0.07
261 0.08
262 0.08
263 0.08
264 0.09
265 0.1