Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MQ17

Protein Details
Accession G4MQ17    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MPSNTKRRGDRARQPNSRKARKARKQAENIQQELNHydrophilic
NLS Segment(s)
PositionSequence
6-25KRRGDRARQPNSRKARKARK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
KEGG mgr:MGG_16077  -  
Amino Acid Sequences MPSNTKRRGDRARQPNSRKARKARKQAENIQQELNRSDVSAQEGNSNSIQQELNRSDVNTQEEKSISDKQDLGSVDKNAQEAPLPQPEEGADPEEYHLTPAEHINATEASSQYKACIPMYVLLRIHGNDFTNYAADVRQFVGTPGWPKTPYTTMTLFRPPFTTGELRLELFYHLRGDGHRLGEITIPFTAFTEGLVSRVLSLPQEPTTNDAYNVPPKMQGLLSHVIHAQSFVQLVAEVPLGQIHVSLNDNVIRRFRRQLGNDIRTAVQPLKDIQLSPVHKIFSMGARTMLLTFARDFRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.89
5 0.88
6 0.88
7 0.89
8 0.88
9 0.91
10 0.92
11 0.91
12 0.91
13 0.91
14 0.9
15 0.88
16 0.81
17 0.76
18 0.68
19 0.6
20 0.51
21 0.43
22 0.33
23 0.25
24 0.22
25 0.16
26 0.2
27 0.2
28 0.19
29 0.22
30 0.22
31 0.25
32 0.25
33 0.24
34 0.18
35 0.18
36 0.19
37 0.14
38 0.21
39 0.2
40 0.23
41 0.23
42 0.24
43 0.23
44 0.26
45 0.31
46 0.26
47 0.25
48 0.25
49 0.24
50 0.25
51 0.27
52 0.3
53 0.27
54 0.27
55 0.27
56 0.24
57 0.28
58 0.28
59 0.28
60 0.24
61 0.24
62 0.23
63 0.24
64 0.24
65 0.19
66 0.18
67 0.16
68 0.14
69 0.16
70 0.2
71 0.2
72 0.19
73 0.2
74 0.2
75 0.21
76 0.19
77 0.18
78 0.13
79 0.11
80 0.13
81 0.14
82 0.13
83 0.12
84 0.12
85 0.09
86 0.09
87 0.1
88 0.12
89 0.1
90 0.1
91 0.11
92 0.11
93 0.11
94 0.12
95 0.11
96 0.1
97 0.11
98 0.11
99 0.1
100 0.12
101 0.13
102 0.11
103 0.12
104 0.11
105 0.15
106 0.17
107 0.2
108 0.18
109 0.17
110 0.18
111 0.17
112 0.17
113 0.14
114 0.13
115 0.1
116 0.11
117 0.1
118 0.1
119 0.09
120 0.08
121 0.07
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.08
129 0.08
130 0.11
131 0.12
132 0.13
133 0.13
134 0.14
135 0.16
136 0.18
137 0.18
138 0.19
139 0.2
140 0.2
141 0.23
142 0.29
143 0.28
144 0.26
145 0.26
146 0.23
147 0.21
148 0.22
149 0.21
150 0.16
151 0.19
152 0.19
153 0.18
154 0.17
155 0.17
156 0.14
157 0.13
158 0.12
159 0.09
160 0.08
161 0.08
162 0.08
163 0.12
164 0.14
165 0.15
166 0.14
167 0.14
168 0.14
169 0.16
170 0.16
171 0.13
172 0.1
173 0.1
174 0.09
175 0.09
176 0.1
177 0.07
178 0.07
179 0.08
180 0.07
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.09
187 0.07
188 0.08
189 0.1
190 0.11
191 0.13
192 0.12
193 0.15
194 0.19
195 0.19
196 0.19
197 0.19
198 0.2
199 0.24
200 0.25
201 0.23
202 0.19
203 0.19
204 0.2
205 0.19
206 0.17
207 0.17
208 0.22
209 0.22
210 0.22
211 0.22
212 0.21
213 0.2
214 0.19
215 0.14
216 0.09
217 0.09
218 0.07
219 0.07
220 0.06
221 0.07
222 0.07
223 0.07
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.05
231 0.07
232 0.09
233 0.09
234 0.11
235 0.15
236 0.17
237 0.19
238 0.26
239 0.27
240 0.29
241 0.36
242 0.41
243 0.46
244 0.49
245 0.57
246 0.62
247 0.64
248 0.63
249 0.59
250 0.53
251 0.45
252 0.44
253 0.36
254 0.27
255 0.23
256 0.23
257 0.25
258 0.25
259 0.24
260 0.24
261 0.3
262 0.31
263 0.34
264 0.36
265 0.32
266 0.31
267 0.32
268 0.31
269 0.29
270 0.31
271 0.26
272 0.24
273 0.24
274 0.24
275 0.23
276 0.23
277 0.17
278 0.15
279 0.15