Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4N887

Protein Details
Accession G4N887    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-78SSYSYRPKPKEGKPKEEKPKEEKAKEAKPKEEKSKEBasic
NLS Segment(s)
PositionSequence
48-78RPKPKEGKPKEEKPKEEKAKEAKPKEEKSKE
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
KEGG mgr:MGG_13546  -  
Amino Acid Sequences MALKESIVPDLVDHCRFEAKPSNSGGGYTLTKKTDCGKQDCNSSYSYRPKPKEGKPKEEKPKEEKAKEAKPKEEKSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.23
4 0.27
5 0.32
6 0.3
7 0.33
8 0.34
9 0.36
10 0.32
11 0.32
12 0.29
13 0.22
14 0.2
15 0.18
16 0.19
17 0.18
18 0.18
19 0.19
20 0.21
21 0.24
22 0.27
23 0.3
24 0.33
25 0.35
26 0.42
27 0.42
28 0.4
29 0.36
30 0.34
31 0.35
32 0.37
33 0.43
34 0.45
35 0.46
36 0.53
37 0.59
38 0.66
39 0.71
40 0.71
41 0.73
42 0.74
43 0.81
44 0.85
45 0.86
46 0.84
47 0.8
48 0.83
49 0.82
50 0.77
51 0.75
52 0.73
53 0.74
54 0.77
55 0.78
56 0.77
57 0.76
58 0.81