Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N873

Protein Details
Accession G4N873    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKTPWRLSRFQKLRQRRRLRAVDDVHydrophilic
80-105IFARYEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG mgr:MGG_06295  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNVLNGGLLWKTPWRLSRFQKLRQRRRLRAVDDVVATLDKALAKKGESLKSLERWKEEMPTEAEMAPRDKYTIFARYEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.13
6 0.17
7 0.24
8 0.28
9 0.36
10 0.43
11 0.53
12 0.59
13 0.66
14 0.73
15 0.77
16 0.83
17 0.85
18 0.89
19 0.86
20 0.88
21 0.87
22 0.81
23 0.78
24 0.71
25 0.64
26 0.53
27 0.45
28 0.36
29 0.27
30 0.22
31 0.12
32 0.09
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.12
39 0.17
40 0.19
41 0.2
42 0.23
43 0.25
44 0.3
45 0.35
46 0.33
47 0.3
48 0.3
49 0.3
50 0.31
51 0.29
52 0.26
53 0.23
54 0.23
55 0.22
56 0.19
57 0.19
58 0.17
59 0.17
60 0.15
61 0.13
62 0.12
63 0.11
64 0.13
65 0.16
66 0.21
67 0.23
68 0.29
69 0.35
70 0.41
71 0.51
72 0.56
73 0.6
74 0.62
75 0.66
76 0.7
77 0.75
78 0.78
79 0.79
80 0.8
81 0.84
82 0.85
83 0.87
84 0.82
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79