FuNGI

Q755E7

Protein Details

Accession

Q755E7

Localization Confidence

High

Confidence Score

16.1

NoLS Segment(s)

Position	Sequence	Protein Nature
557-590	LEQTYGNKWRTKRNKKTFARRKRIYKFILNGVRN	Hydrophilic

NLS Segment(s)

Position	Sequence
565-579	WRTKRNKKTFARRKR

Subcellular Location(s)

nucl 21, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR022210 TF_GCR1-like
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0060963 P:positive regulation of ribosomal protein gene transcription by RNA polymerase II
KEGG	ago:AGOS_AFL124C -
Pfam	View protein in Pfam PF12550 GCR1_C

Amino Acid Sequences

MIDPVTHIVTPSNDEQRQGRSDGGMQLGLEDLHGGGGGLGQQKVSGMAEGTDSIVDVLTNPSSSVNLHSNILSVSTNVEEGQGMQPAAIQGGGTAAGRRFSSVPISDSPVGCGQHGMGTASTQVPSHGSTANLLSMGNPVATNVQVCQRMDEVSARLIVMEETVNKLLGNIDAQQQQIASMRSESMEMLGSLMKEVRELKQQVPVLDDPDNNEKDKFVTDLLNSITNVSSNYLKKVSSRNLQRFKRQRDIMSTSDLPSLGNTQSSSHFMQDLVNPYASTQDFQSFTVLKDKAKEFTLNPTAINKRRRLSAQPLNTLQMSQDQLQQQRGSVQSLISIPTSGQKNANFGPQLQNYLIGLQNIPMSEAEKVSSPTVLKQFQNSTTDPDLKTGRRNPGLDFQIGSGDDENDENDGASGEDEDGYLEDDEGYRSQSQRTMSSEDDEQFTGGNQGEDEAGPRAAGRNPKSLPSSIVRRFANSGSQVSVSGTPETERLVLKNNDKYDKNTMPAPNTKPRAVLASNPEDTLTDVQYTMVKAPDSVRAIWDEYTIGVGGKPSIRQLEQTYGNKWRTKRNKKTFARRKRIYKFILNGVRNGKSESEMIDILESRRVYRTEDNELKKRTIGWLQQSLSGI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.34
2	0.37
3	0.41
4	0.43
5	0.41
6	0.37
7	0.3
8	0.33
9	0.34
10	0.33
11	0.27
12	0.23
13	0.21
14	0.2
15	0.17
16	0.13
17	0.09
18	0.07
19	0.05
20	0.05
21	0.05
22	0.04
23	0.04
24	0.07
25	0.1
26	0.1
27	0.1
28	0.1
29	0.11
30	0.12
31	0.12
32	0.1
33	0.08
34	0.08
35	0.09
36	0.1
37	0.1
38	0.09
39	0.08
40	0.08
41	0.07
42	0.06
43	0.06
44	0.08
45	0.08
46	0.09
47	0.09
48	0.09
49	0.1
50	0.11
51	0.15
52	0.17
53	0.18
54	0.19
55	0.19
56	0.19
57	0.18
58	0.19
59	0.15
60	0.11
61	0.11
62	0.1
63	0.11
64	0.1
65	0.1
66	0.09
67	0.11
68	0.12
69	0.12
70	0.12
71	0.11
72	0.11
73	0.11
74	0.11
75	0.09
76	0.07
77	0.04
78	0.05
79	0.06
80	0.06
81	0.07
82	0.08
83	0.1
84	0.1
85	0.13
86	0.13
87	0.14
88	0.2
89	0.2
90	0.22
91	0.23
92	0.29
93	0.3
94	0.29
95	0.31
96	0.29
97	0.28
98	0.24
99	0.22
100	0.16
101	0.15
102	0.16
103	0.14
104	0.1
105	0.1
106	0.11
107	0.12
108	0.12
109	0.1
110	0.1
111	0.1
112	0.11
113	0.13
114	0.13
115	0.12
116	0.13
117	0.14
118	0.14
119	0.13
120	0.11
121	0.1
122	0.1
123	0.1
124	0.09
125	0.07
126	0.07
127	0.08
128	0.08
129	0.09
130	0.08
131	0.13
132	0.17
133	0.17
134	0.19
135	0.19
136	0.19
137	0.2
138	0.22
139	0.18
140	0.15
141	0.16
142	0.14
143	0.13
144	0.12
145	0.1
146	0.08
147	0.08
148	0.07
149	0.09
150	0.1
151	0.1
152	0.1
153	0.1
154	0.1
155	0.09
156	0.1
157	0.09
158	0.13
159	0.15
160	0.15
161	0.15
162	0.15
163	0.15
164	0.17
165	0.16
166	0.13
167	0.11
168	0.11
169	0.11
170	0.12
171	0.11
172	0.09
173	0.08
174	0.07
175	0.07
176	0.08
177	0.07
178	0.07
179	0.08
180	0.07
181	0.08
182	0.1
183	0.12
184	0.19
185	0.22
186	0.23
187	0.29
188	0.31
189	0.3
190	0.33
191	0.32
192	0.27
193	0.27
194	0.26
195	0.22
196	0.27
197	0.28
198	0.25
199	0.25
200	0.22
201	0.2
202	0.2
203	0.18
204	0.12
205	0.13
206	0.12
207	0.14
208	0.15
209	0.16
210	0.15
211	0.15
212	0.13
213	0.11
214	0.11
215	0.1
216	0.14
217	0.13
218	0.15
219	0.16
220	0.16
221	0.19
222	0.25
223	0.3
224	0.34
225	0.43
226	0.51
227	0.6
228	0.64
229	0.72
230	0.75
231	0.77
232	0.78
233	0.73
234	0.66
235	0.64
236	0.65
237	0.57
238	0.53
239	0.46
240	0.38
241	0.34
242	0.3
243	0.22
244	0.16
245	0.16
246	0.1
247	0.1
248	0.09
249	0.09
250	0.1
251	0.14
252	0.14
253	0.13
254	0.13
255	0.12
256	0.13
257	0.15
258	0.18
259	0.16
260	0.16
261	0.15
262	0.14
263	0.17
264	0.16
265	0.14
266	0.1
267	0.11
268	0.12
269	0.12
270	0.14
271	0.12
272	0.13
273	0.19
274	0.19
275	0.17
276	0.2
277	0.21
278	0.21
279	0.22
280	0.23
281	0.17
282	0.24
283	0.28
284	0.25
285	0.24
286	0.27
287	0.31
288	0.36
289	0.41
290	0.39
291	0.35
292	0.38
293	0.41
294	0.41
295	0.44
296	0.46
297	0.47
298	0.48
299	0.47
300	0.46
301	0.42
302	0.37
303	0.28
304	0.22
305	0.17
306	0.12
307	0.15
308	0.17
309	0.19
310	0.22
311	0.21
312	0.19
313	0.2
314	0.2
315	0.17
316	0.14
317	0.12
318	0.11
319	0.11
320	0.12
321	0.09
322	0.09
323	0.07
324	0.11
325	0.13
326	0.13
327	0.15
328	0.15
329	0.18
330	0.19
331	0.23
332	0.19
333	0.18
334	0.23
335	0.21
336	0.23
337	0.2
338	0.2
339	0.16
340	0.17
341	0.16
342	0.11
343	0.1
344	0.08
345	0.09
346	0.08
347	0.08
348	0.07
349	0.07
350	0.07
351	0.07
352	0.07
353	0.07
354	0.09
355	0.08
356	0.1
357	0.09
358	0.12
359	0.17
360	0.2
361	0.2
362	0.22
363	0.25
364	0.27
365	0.31
366	0.28
367	0.29
368	0.29
369	0.32
370	0.29
371	0.29
372	0.3
373	0.27
374	0.34
375	0.34
376	0.38
377	0.39
378	0.4
379	0.4
380	0.44
381	0.45
382	0.39
383	0.33
384	0.26
385	0.23
386	0.22
387	0.2
388	0.12
389	0.1
390	0.09
391	0.09
392	0.08
393	0.07
394	0.06
395	0.06
396	0.05
397	0.05
398	0.05
399	0.05
400	0.05
401	0.04
402	0.04
403	0.04
404	0.04
405	0.04
406	0.06
407	0.06
408	0.05
409	0.05
410	0.05
411	0.06
412	0.07
413	0.09
414	0.09
415	0.1
416	0.11
417	0.15
418	0.17
419	0.19
420	0.22
421	0.25
422	0.24
423	0.26
424	0.28
425	0.26
426	0.26
427	0.23
428	0.19
429	0.15
430	0.14
431	0.13
432	0.1
433	0.09
434	0.07
435	0.07
436	0.08
437	0.08
438	0.09
439	0.08
440	0.08
441	0.07
442	0.08
443	0.09
444	0.12
445	0.2
446	0.22
447	0.29
448	0.3
449	0.34
450	0.38
451	0.37
452	0.37
453	0.36
454	0.42
455	0.39
456	0.45
457	0.42
458	0.41
459	0.42
460	0.4
461	0.4
462	0.34
463	0.3
464	0.25
465	0.24
466	0.22
467	0.22
468	0.22
469	0.17
470	0.15
471	0.13
472	0.12
473	0.12
474	0.13
475	0.14
476	0.13
477	0.12
478	0.19
479	0.24
480	0.3
481	0.37
482	0.41
483	0.46
484	0.48
485	0.52
486	0.53
487	0.52
488	0.48
489	0.48
490	0.46
491	0.46
492	0.52
493	0.54
494	0.55
495	0.56
496	0.54
497	0.49
498	0.45
499	0.45
500	0.39
501	0.38
502	0.36
503	0.38
504	0.38
505	0.37
506	0.36
507	0.3
508	0.3
509	0.26
510	0.2
511	0.13
512	0.12
513	0.12
514	0.14
515	0.14
516	0.14
517	0.14
518	0.12
519	0.13
520	0.15
521	0.21
522	0.22
523	0.22
524	0.22
525	0.23
526	0.24
527	0.24
528	0.23
529	0.16
530	0.13
531	0.14
532	0.12
533	0.1
534	0.08
535	0.08
536	0.09
537	0.11
538	0.12
539	0.14
540	0.19
541	0.19
542	0.23
543	0.27
544	0.32
545	0.39
546	0.42
547	0.45
548	0.49
549	0.55
550	0.57
551	0.56
552	0.6
553	0.63
554	0.7
555	0.75
556	0.78
557	0.82
558	0.87
559	0.95
560	0.95
561	0.95
562	0.95
563	0.94
564	0.94
565	0.92
566	0.91
567	0.87
568	0.86
569	0.81
570	0.8
571	0.8
572	0.71
573	0.69
574	0.65
575	0.62
576	0.53
577	0.49
578	0.4
579	0.33
580	0.32
581	0.28
582	0.25
583	0.21
584	0.2
585	0.2
586	0.2
587	0.19
588	0.23
589	0.21
590	0.19
591	0.23
592	0.23
593	0.27
594	0.33
595	0.38
596	0.43
597	0.53
598	0.6
599	0.65
600	0.69
601	0.66
602	0.59
603	0.55
604	0.5
605	0.5
606	0.49
607	0.49
608	0.53
609	0.52

Q755E7

3D AlphaFold-predicted Structure Viewer