FuNGI

G4N582

Protein Details

Accession

G4N582

Localization Confidence

High

Confidence Score

16.2

NoLS Segment(s)

Position	Sequence	Protein Nature
356-377	EYAPAVKKGKKGKKTNAAPDAA	Hydrophilic

NLS Segment(s)

Position	Sequence
262-281	KQKARERRKAEDAKRAQEFK
361-369	VKKGKKGKK

Subcellular Location(s)

nucl 24, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR039604 Bfr1
Gene Ontology	GO:0005829 C:cytosol GO:0042175 C:nuclear outer membrane-endoplasmic reticulum membrane network GO:1990904 C:ribonucleoprotein complex GO:0016071 P:mRNA metabolic process
KEGG	mgr:MGG_06082 -

Amino Acid Sequences

MAEAATNTAAPAVRPTKPDEAAYKEKLAQAEKEHSDVMTKYNAIKAKIDIAQPNKNKDAPNPTQKRRQELIAQANEIRQKQAGGKNARQTKQDQIKRLDEQLRSRIAEQKNARGKVNFKSVEEVDREISRLEKQIEGGTMRIVDEKKALDEMSNLRKLRKNFAQFDNQQKEIDDLRNKIKEVKDSMDNPEQKALSEQYNKIQAEIDVIKAEQDEAYKGLSSLRDERTKLQNEQREKFEAIRKIKDEYYAQKKAYSNFEWEAKQKARERRKAEDAKRAQEFKMERAKKMLAEASDPAYLEEIRRANSLIRFFDPSHQGETRAPLLASSGLSAEATRKVDDSGLKGTRLMSKKDRDDEYAPAVKKGKKGKKTNAAPDAAASGKFSCPPSVMEDCAFMGIEPPMSAADVPAVLEKAKAKLEHWKSDQAAQTQKNIDKAKKEIEKIEAEEAAGHDANGDSKEDKAVAGVTSDLKETAIEDKKDEETKA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.33
3	0.38
4	0.41
5	0.45
6	0.44
7	0.47
8	0.52
9	0.54
10	0.52
11	0.48
12	0.48
13	0.48
14	0.45
15	0.42
16	0.4
17	0.44
18	0.42
19	0.41
20	0.38
21	0.34
22	0.34
23	0.3
24	0.27
25	0.23
26	0.22
27	0.21
28	0.26
29	0.3
30	0.29
31	0.3
32	0.29
33	0.31
34	0.34
35	0.38
36	0.4
37	0.43
38	0.5
39	0.54
40	0.59
41	0.58
42	0.58
43	0.55
44	0.54
45	0.57
46	0.56
47	0.62
48	0.65
49	0.68
50	0.73
51	0.76
52	0.78
53	0.71
54	0.68
55	0.65
56	0.64
57	0.67
58	0.62
59	0.6
60	0.53
61	0.54
62	0.54
63	0.46
64	0.38
65	0.29
66	0.25
67	0.29
68	0.33
69	0.37
70	0.41
71	0.46
72	0.54
73	0.62
74	0.64
75	0.61
76	0.59
77	0.6
78	0.62
79	0.63
80	0.62
81	0.6
82	0.64
83	0.63
84	0.68
85	0.65
86	0.6
87	0.59
88	0.58
89	0.56
90	0.51
91	0.49
92	0.49
93	0.44
94	0.48
95	0.46
96	0.49
97	0.52
98	0.53
99	0.55
100	0.5
101	0.52
102	0.49
103	0.55
104	0.48
105	0.4
106	0.42
107	0.4
108	0.41
109	0.39
110	0.35
111	0.27
112	0.25
113	0.25
114	0.2
115	0.2
116	0.17
117	0.19
118	0.19
119	0.17
120	0.18
121	0.19
122	0.21
123	0.2
124	0.19
125	0.15
126	0.13
127	0.13
128	0.16
129	0.14
130	0.12
131	0.14
132	0.14
133	0.14
134	0.15
135	0.15
136	0.11
137	0.14
138	0.19
139	0.25
140	0.31
141	0.31
142	0.34
143	0.39
144	0.4
145	0.45
146	0.48
147	0.49
148	0.49
149	0.53
150	0.59
151	0.6
152	0.68
153	0.66
154	0.58
155	0.5
156	0.44
157	0.41
158	0.34
159	0.35
160	0.29
161	0.27
162	0.32
163	0.34
164	0.34
165	0.38
166	0.37
167	0.36
168	0.35
169	0.36
170	0.35
171	0.35
172	0.4
173	0.43
174	0.43
175	0.38
176	0.38
177	0.34
178	0.28
179	0.28
180	0.24
181	0.21
182	0.24
183	0.24
184	0.24
185	0.31
186	0.31
187	0.29
188	0.27
189	0.22
190	0.21
191	0.2
192	0.18
193	0.11
194	0.11
195	0.1
196	0.1
197	0.1
198	0.06
199	0.06
200	0.06
201	0.06
202	0.07
203	0.06
204	0.07
205	0.08
206	0.08
207	0.1
208	0.15
209	0.19
210	0.22
211	0.23
212	0.28
213	0.35
214	0.38
215	0.41
216	0.43
217	0.46
218	0.49
219	0.51
220	0.5
221	0.45
222	0.42
223	0.41
224	0.39
225	0.41
226	0.38
227	0.39
228	0.37
229	0.36
230	0.35
231	0.34
232	0.32
233	0.32
234	0.36
235	0.38
236	0.37
237	0.38
238	0.4
239	0.4
240	0.42
241	0.36
242	0.32
243	0.28
244	0.31
245	0.28
246	0.28
247	0.32
248	0.28
249	0.32
250	0.35
251	0.42
252	0.49
253	0.56
254	0.6
255	0.61
256	0.69
257	0.73
258	0.72
259	0.73
260	0.69
261	0.67
262	0.67
263	0.62
264	0.52
265	0.48
266	0.43
267	0.39
268	0.43
269	0.39
270	0.35
271	0.36
272	0.38
273	0.32
274	0.34
275	0.3
276	0.2
277	0.2
278	0.2
279	0.18
280	0.18
281	0.17
282	0.14
283	0.13
284	0.12
285	0.1
286	0.13
287	0.12
288	0.12
289	0.13
290	0.14
291	0.15
292	0.19
293	0.22
294	0.2
295	0.21
296	0.24
297	0.24
298	0.28
299	0.3
300	0.28
301	0.3
302	0.28
303	0.28
304	0.26
305	0.28
306	0.25
307	0.21
308	0.19
309	0.14
310	0.14
311	0.13
312	0.12
313	0.09
314	0.08
315	0.06
316	0.07
317	0.07
318	0.08
319	0.1
320	0.11
321	0.11
322	0.11
323	0.12
324	0.14
325	0.16
326	0.18
327	0.22
328	0.23
329	0.23
330	0.23
331	0.24
332	0.29
333	0.31
334	0.34
335	0.34
336	0.4
337	0.47
338	0.53
339	0.54
340	0.52
341	0.51
342	0.5
343	0.49
344	0.48
345	0.42
346	0.39
347	0.42
348	0.4
349	0.43
350	0.49
351	0.52
352	0.54
353	0.64
354	0.7
355	0.76
356	0.82
357	0.86
358	0.83
359	0.77
360	0.67
361	0.57
362	0.5
363	0.4
364	0.31
365	0.22
366	0.15
367	0.14
368	0.16
369	0.17
370	0.15
371	0.15
372	0.16
373	0.21
374	0.23
375	0.24
376	0.22
377	0.22
378	0.21
379	0.21
380	0.19
381	0.13
382	0.11
383	0.09
384	0.09
385	0.07
386	0.07
387	0.07
388	0.07
389	0.08
390	0.06
391	0.06
392	0.06
393	0.07
394	0.07
395	0.08
396	0.07
397	0.1
398	0.11
399	0.14
400	0.18
401	0.19
402	0.19
403	0.29
404	0.37
405	0.44
406	0.47
407	0.53
408	0.51
409	0.56
410	0.6
411	0.56
412	0.58
413	0.51
414	0.53
415	0.52
416	0.53
417	0.54
418	0.55
419	0.54
420	0.51
421	0.54
422	0.57
423	0.58
424	0.6
425	0.57
426	0.57
427	0.57
428	0.54
429	0.53
430	0.44
431	0.36
432	0.33
433	0.28
434	0.26
435	0.2
436	0.16
437	0.12
438	0.12
439	0.14
440	0.13
441	0.15
442	0.11
443	0.12
444	0.14
445	0.14
446	0.14
447	0.13
448	0.13
449	0.12
450	0.12
451	0.13
452	0.14
453	0.14
454	0.15
455	0.14
456	0.13
457	0.13
458	0.13
459	0.2
460	0.25
461	0.26
462	0.27
463	0.3
464	0.36

G4N582

3D AlphaFold-predicted Structure Viewer