Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5G8Z2

Protein Details
Accession C5G8Z2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
181-200KNPSEKSKWRRKLAELRRNSHydrophilic
NLS Segment(s)
PositionSequence
188-192KWRRK
Subcellular Location(s) mito 10, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
Pfam View protein in Pfam  
PF01636  APH  
CDD cd05120  APH_ChoK_like  
Amino Acid Sequences MLAFLVNKFRQQNNSESRTGHSERRYDGSFDGETIYDYFGNLVIKSHNIRDGHPVAIKFKTVGFFWESEADMMAYAHSQNLLAPAVWECRQLDSHRIAMIADFVPGNPLDEVWPTLDEQQRMSITEQLADHLKLFRSCTQPYIGRVNRQPTYNPYEGIERKLMGPFNSEADFDQWCLSRIKNPSEKSKWRRKLAELRRNSQSKFVLTHGDLFPRNILVKEGKITGIVDWERSGFYPEYVEYALAACLYDYGGEEWWKPLLMEALTPCIPERLEVQSVIYKRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.52
4 0.51
5 0.52
6 0.52
7 0.5
8 0.47
9 0.46
10 0.46
11 0.5
12 0.49
13 0.44
14 0.4
15 0.38
16 0.32
17 0.27
18 0.25
19 0.2
20 0.18
21 0.16
22 0.16
23 0.11
24 0.1
25 0.1
26 0.1
27 0.11
28 0.1
29 0.1
30 0.1
31 0.14
32 0.16
33 0.18
34 0.23
35 0.23
36 0.24
37 0.31
38 0.32
39 0.33
40 0.34
41 0.33
42 0.31
43 0.31
44 0.3
45 0.23
46 0.22
47 0.2
48 0.17
49 0.18
50 0.17
51 0.16
52 0.17
53 0.19
54 0.17
55 0.15
56 0.15
57 0.13
58 0.1
59 0.09
60 0.07
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.07
68 0.07
69 0.06
70 0.07
71 0.08
72 0.11
73 0.12
74 0.14
75 0.12
76 0.14
77 0.17
78 0.18
79 0.22
80 0.22
81 0.23
82 0.22
83 0.22
84 0.2
85 0.17
86 0.17
87 0.12
88 0.1
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.06
95 0.06
96 0.06
97 0.07
98 0.08
99 0.07
100 0.08
101 0.08
102 0.12
103 0.15
104 0.15
105 0.15
106 0.17
107 0.17
108 0.18
109 0.18
110 0.17
111 0.14
112 0.16
113 0.15
114 0.13
115 0.14
116 0.13
117 0.13
118 0.11
119 0.12
120 0.1
121 0.13
122 0.16
123 0.19
124 0.19
125 0.2
126 0.23
127 0.24
128 0.26
129 0.34
130 0.31
131 0.32
132 0.35
133 0.39
134 0.38
135 0.37
136 0.35
137 0.31
138 0.36
139 0.32
140 0.29
141 0.24
142 0.29
143 0.29
144 0.3
145 0.26
146 0.19
147 0.19
148 0.2
149 0.21
150 0.14
151 0.16
152 0.14
153 0.15
154 0.15
155 0.15
156 0.13
157 0.13
158 0.13
159 0.11
160 0.12
161 0.1
162 0.11
163 0.11
164 0.11
165 0.15
166 0.2
167 0.27
168 0.33
169 0.37
170 0.45
171 0.53
172 0.63
173 0.67
174 0.73
175 0.75
176 0.76
177 0.78
178 0.77
179 0.79
180 0.8
181 0.81
182 0.77
183 0.74
184 0.74
185 0.74
186 0.66
187 0.61
188 0.53
189 0.46
190 0.4
191 0.36
192 0.33
193 0.28
194 0.33
195 0.27
196 0.29
197 0.27
198 0.25
199 0.24
200 0.21
201 0.21
202 0.16
203 0.18
204 0.16
205 0.17
206 0.19
207 0.19
208 0.17
209 0.17
210 0.17
211 0.14
212 0.18
213 0.17
214 0.16
215 0.15
216 0.16
217 0.16
218 0.15
219 0.19
220 0.13
221 0.13
222 0.14
223 0.14
224 0.16
225 0.15
226 0.15
227 0.11
228 0.11
229 0.11
230 0.09
231 0.08
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.07
238 0.09
239 0.1
240 0.11
241 0.12
242 0.13
243 0.14
244 0.12
245 0.13
246 0.14
247 0.13
248 0.16
249 0.16
250 0.21
251 0.21
252 0.22
253 0.21
254 0.2
255 0.19
256 0.17
257 0.18
258 0.19
259 0.21
260 0.21
261 0.24
262 0.29
263 0.3