Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NDN2

Protein Details
Accession G4NDN2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
86-113KEKSNGKTKDKGKKGSKKSKKKGAAAEDBasic
NLS Segment(s)
PositionSequence
86-108KEKSNGKTKDKGKKGSKKSKKKG
Subcellular Location(s) cyto_nucl 16, cyto 14.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0000070  P:mitotic sister chromatid segregation  
KEGG mgr:MGG_00906  -  
Pfam View protein in Pfam  
PF08641  Mis14  
Amino Acid Sequences MDAAASAHRKVELQSPEDFTYLLNNVRRAAAESIGAAFPLADDDAEDALRARIEELVDDYIARTFALAAPNVSINGLPVPESLLPKEKSNGKTKDKGKKGSKKSKKKGAAAEDEDENVVYEPFDARLRDRIPDLLREEEELLREIAALKRRVPAQAATRVGDALKAGVAADEAALAAAKERVGDVDRDLRAKGRKRMLDSLEGGVDEGSAAAAPAISVLQRNDEVAESFGTAVEGLGRLKRDMPATVARMERARAAGSYVIAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.37
5 0.35
6 0.27
7 0.25
8 0.24
9 0.26
10 0.24
11 0.24
12 0.25
13 0.26
14 0.27
15 0.26
16 0.26
17 0.21
18 0.17
19 0.16
20 0.17
21 0.16
22 0.15
23 0.11
24 0.08
25 0.07
26 0.07
27 0.07
28 0.04
29 0.05
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.07
38 0.07
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.1
48 0.1
49 0.09
50 0.06
51 0.05
52 0.08
53 0.1
54 0.1
55 0.1
56 0.11
57 0.11
58 0.11
59 0.11
60 0.09
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.08
67 0.1
68 0.11
69 0.12
70 0.18
71 0.2
72 0.21
73 0.25
74 0.3
75 0.33
76 0.42
77 0.49
78 0.49
79 0.56
80 0.64
81 0.7
82 0.7
83 0.75
84 0.76
85 0.77
86 0.82
87 0.84
88 0.86
89 0.87
90 0.89
91 0.9
92 0.88
93 0.84
94 0.82
95 0.78
96 0.76
97 0.68
98 0.61
99 0.51
100 0.43
101 0.36
102 0.28
103 0.2
104 0.12
105 0.07
106 0.05
107 0.04
108 0.04
109 0.05
110 0.07
111 0.07
112 0.08
113 0.13
114 0.14
115 0.15
116 0.16
117 0.19
118 0.19
119 0.22
120 0.24
121 0.21
122 0.21
123 0.21
124 0.21
125 0.17
126 0.17
127 0.13
128 0.11
129 0.08
130 0.08
131 0.08
132 0.09
133 0.14
134 0.15
135 0.15
136 0.18
137 0.19
138 0.2
139 0.21
140 0.23
141 0.23
142 0.29
143 0.3
144 0.28
145 0.28
146 0.27
147 0.25
148 0.21
149 0.15
150 0.08
151 0.06
152 0.05
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.07
170 0.08
171 0.1
172 0.17
173 0.18
174 0.19
175 0.2
176 0.24
177 0.3
178 0.37
179 0.42
180 0.44
181 0.49
182 0.53
183 0.61
184 0.6
185 0.58
186 0.53
187 0.48
188 0.4
189 0.34
190 0.28
191 0.2
192 0.16
193 0.09
194 0.06
195 0.04
196 0.03
197 0.03
198 0.03
199 0.02
200 0.02
201 0.03
202 0.03
203 0.04
204 0.06
205 0.07
206 0.1
207 0.1
208 0.11
209 0.12
210 0.13
211 0.13
212 0.13
213 0.13
214 0.11
215 0.1
216 0.1
217 0.09
218 0.08
219 0.07
220 0.06
221 0.07
222 0.07
223 0.1
224 0.12
225 0.13
226 0.15
227 0.18
228 0.2
229 0.2
230 0.24
231 0.29
232 0.31
233 0.35
234 0.35
235 0.35
236 0.35
237 0.35
238 0.33
239 0.27
240 0.26
241 0.21
242 0.22
243 0.21
244 0.19