Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4NC62

Protein Details
Accession G4NC62    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-117ASPSPHRERKWARGLCRQRLGIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
KEGG mgr:MGG_17314  -  
Amino Acid Sequences MNWYQRIGRKGRNKDGGYNKNGGGYSGAGSTFVGARKVKVYRLNRIQAQRRIHPYDFVVGLNGARTTLSKVLGRGVARKSHLGLRQDGLVAPPATASPSPHRERKWARGLCRQRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.78
4 0.73
5 0.67
6 0.58
7 0.52
8 0.48
9 0.39
10 0.29
11 0.21
12 0.17
13 0.13
14 0.13
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.12
21 0.11
22 0.13
23 0.17
24 0.19
25 0.23
26 0.3
27 0.35
28 0.4
29 0.48
30 0.53
31 0.55
32 0.62
33 0.66
34 0.64
35 0.65
36 0.61
37 0.6
38 0.6
39 0.55
40 0.48
41 0.4
42 0.35
43 0.3
44 0.24
45 0.17
46 0.11
47 0.1
48 0.09
49 0.08
50 0.05
51 0.04
52 0.05
53 0.06
54 0.08
55 0.1
56 0.1
57 0.11
58 0.13
59 0.16
60 0.17
61 0.2
62 0.21
63 0.24
64 0.25
65 0.26
66 0.26
67 0.29
68 0.33
69 0.31
70 0.31
71 0.28
72 0.27
73 0.27
74 0.25
75 0.19
76 0.19
77 0.16
78 0.13
79 0.12
80 0.1
81 0.12
82 0.13
83 0.16
84 0.19
85 0.27
86 0.33
87 0.4
88 0.43
89 0.51
90 0.59
91 0.65
92 0.69
93 0.68
94 0.7
95 0.74
96 0.82
97 0.81