Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4N5E1

Protein Details
Accession G4N5E1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-49IVKKRTKSFMRHQSDRFKRVDPSWRKPKGIDNRVRRRFRGBasic
NLS Segment(s)
PositionSequence
13-16KRTK
20-48RHQSDRFKRVDPSWRKPKGIDNRVRRRFR
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgr:MGG_05248  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAAKHTAIVKKRTKSFMRHQSDRFKRVDPSWRKPKGIDNRVRRRFRGNIAMPSIGYGSNKRTKHMMPSGHKAFLVQNINDVELLLMHNQVFAAEIAHNVSSRKRIEIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.69
4 0.73
5 0.75
6 0.76
7 0.76
8 0.77
9 0.79
10 0.81
11 0.79
12 0.72
13 0.65
14 0.6
15 0.57
16 0.61
17 0.59
18 0.6
19 0.64
20 0.67
21 0.66
22 0.63
23 0.67
24 0.68
25 0.68
26 0.68
27 0.68
28 0.73
29 0.8
30 0.83
31 0.76
32 0.72
33 0.67
34 0.63
35 0.62
36 0.56
37 0.52
38 0.5
39 0.48
40 0.41
41 0.36
42 0.31
43 0.21
44 0.16
45 0.12
46 0.13
47 0.2
48 0.2
49 0.21
50 0.23
51 0.24
52 0.3
53 0.35
54 0.38
55 0.36
56 0.44
57 0.46
58 0.44
59 0.43
60 0.37
61 0.32
62 0.29
63 0.28
64 0.2
65 0.2
66 0.19
67 0.2
68 0.19
69 0.18
70 0.11
71 0.08
72 0.09
73 0.05
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.05
81 0.06
82 0.05
83 0.06
84 0.07
85 0.08
86 0.09
87 0.09
88 0.11
89 0.16
90 0.17
91 0.19
92 0.2
93 0.22
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47