Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NCF4

Protein Details
Accession G4NCF4    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGCCCSKTSKAPRPQPGPQSYHHydrophilic
121-143SEAPLRAEGKKRDPRQNRSDPYHHydrophilic
NLS Segment(s)
PositionSequence
129-132GKKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
KEGG mgr:MGG_00389  -  
Amino Acid Sequences MGCCCSKTSKAPRPQPGPQSYHAPASWRPEHEKKPTNKGPAPGTRVAPLPRPPGDVRYKYTADGTPWPQAMEAYRIGVRSGGRPDTESSLSPRQLPSPQPPSSGSPTTPSSTGTVVRKKNSEAPLRAEGKKRDPRQNRSDPYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.81
4 0.76
5 0.69
6 0.67
7 0.6
8 0.56
9 0.49
10 0.42
11 0.38
12 0.4
13 0.42
14 0.38
15 0.44
16 0.47
17 0.54
18 0.6
19 0.65
20 0.64
21 0.69
22 0.72
23 0.73
24 0.69
25 0.67
26 0.65
27 0.63
28 0.63
29 0.56
30 0.5
31 0.42
32 0.42
33 0.38
34 0.36
35 0.33
36 0.33
37 0.3
38 0.33
39 0.32
40 0.35
41 0.41
42 0.4
43 0.39
44 0.38
45 0.38
46 0.34
47 0.36
48 0.31
49 0.25
50 0.26
51 0.25
52 0.22
53 0.21
54 0.2
55 0.18
56 0.17
57 0.15
58 0.13
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.11
66 0.11
67 0.14
68 0.14
69 0.14
70 0.15
71 0.17
72 0.19
73 0.2
74 0.18
75 0.21
76 0.24
77 0.25
78 0.25
79 0.24
80 0.23
81 0.26
82 0.29
83 0.32
84 0.35
85 0.35
86 0.36
87 0.38
88 0.4
89 0.42
90 0.4
91 0.33
92 0.29
93 0.31
94 0.3
95 0.28
96 0.25
97 0.21
98 0.2
99 0.24
100 0.27
101 0.32
102 0.36
103 0.4
104 0.41
105 0.43
106 0.5
107 0.53
108 0.55
109 0.52
110 0.53
111 0.57
112 0.6
113 0.62
114 0.61
115 0.6
116 0.61
117 0.67
118 0.69
119 0.71
120 0.76
121 0.8
122 0.83
123 0.88