Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G5EI46

Protein Details
Accession G5EI46    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-135SKRMMKEITQWQKRQRENRYKGSWRLWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7.5, cyto_nucl 6.5, extr 5, cyto 4.5, plas 3, golg 3, mito 2
Family & Domain DBs
KEGG mgr:MGG_18020  -  
Amino Acid Sequences MQQLDLLKTLAVVALIVPAAIALPTRTESSISSFDAPVTSLADIQESPLKDRRRREEAKKGCTCKGKCADCAWEGLRITPPQCEAADVLDNKEQTESSGPGVVYALQESKRMMKEITQWQKRQRENRYKGSWRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.07
12 0.09
13 0.1
14 0.11
15 0.12
16 0.16
17 0.19
18 0.2
19 0.2
20 0.19
21 0.18
22 0.17
23 0.17
24 0.13
25 0.11
26 0.09
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.12
33 0.11
34 0.14
35 0.2
36 0.27
37 0.32
38 0.39
39 0.45
40 0.51
41 0.59
42 0.64
43 0.68
44 0.71
45 0.76
46 0.77
47 0.73
48 0.69
49 0.7
50 0.62
51 0.6
52 0.59
53 0.51
54 0.45
55 0.44
56 0.42
57 0.34
58 0.36
59 0.28
60 0.24
61 0.21
62 0.2
63 0.2
64 0.18
65 0.18
66 0.15
67 0.15
68 0.14
69 0.14
70 0.14
71 0.11
72 0.12
73 0.16
74 0.16
75 0.17
76 0.17
77 0.17
78 0.17
79 0.17
80 0.14
81 0.11
82 0.14
83 0.13
84 0.11
85 0.14
86 0.14
87 0.13
88 0.14
89 0.13
90 0.11
91 0.11
92 0.12
93 0.1
94 0.12
95 0.13
96 0.18
97 0.19
98 0.21
99 0.21
100 0.21
101 0.29
102 0.39
103 0.48
104 0.52
105 0.58
106 0.65
107 0.74
108 0.79
109 0.81
110 0.81
111 0.82
112 0.82
113 0.85
114 0.86
115 0.85