FuNGI

G4MZU4

Protein Details

Accession

G4MZU4

Localization Confidence

Low

Confidence Score

8.8

NoLS Segment(s)

Position	Sequence	Protein Nature
503-532	DPDQPIWKQPTNPRRKRNAERGRMIYQRPR	Hydrophilic

NLS Segment(s)

Position	Sequence
516-521	RRKRNA

Subcellular Location(s)

cyto 8, mito 7, extr 7, nucl 2, plas 2

Family & Domain DBs

InterPro	View protein in InterPro IPR005322 Peptidase_C69
Gene Ontology	GO:0070004 F:cysteine-type exopeptidase activity GO:0016805 F:dipeptidase activity GO:0006508 P:proteolysis
KEGG	mgr:MGG_15184 -
Pfam	View protein in Pfam PF03577 Peptidase_C69

Amino Acid Sequences

MVTSTAAVLTAAVALAGPAAASYAFYVGRDLTADGSVMVGGTGEEVSSHWLQLFPARDHGANATVTVGVTPQASIPGELFQIPQVSHTFRYLSMEYSDFEGFPAPLTNGGVNEHGVAVRDVWAQNRDELVAMTPTPQRGVQYSDLARIVLERATTAREGVEIIGRLMDRYGEATYGGNTHLVADKDEGWVVWEMAGGKKLWAAERLKSDVVRVLYPGYIEDFPVDFANSSDHMGSANIVSFAVEQGWWDPEGGEAFNIFNAYGDRGGNKTARDGGFKFMSQAALEDATLAMKPLTEEKLMERVRDVRISDDEAGYGQVLSLKAGVDRDLLRVWIAPTGSVAAPFVPWWLGVDGIPPEFGEHRYLTTGASSSFLNPDFELQEASEFAGRIFKRVLYYMCSAPDAFHPVVTSMLTGFENQSRSDVDWVQKSAELLIKSGDRQTASRLLTYYSHSRAAKALELGKSMAAALDGYIKLTGRWKNPVGSEINDAGEGAETVNCLVGYDPDQPIWKQPTNPRRKRNAERGRMIYQRPRL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.03
2	0.04
3	0.03
4	0.03
5	0.02
6	0.03
7	0.03
8	0.04
9	0.05
10	0.07
11	0.07
12	0.08
13	0.09
14	0.09
15	0.1
16	0.11
17	0.11
18	0.11
19	0.11
20	0.11
21	0.09
22	0.09
23	0.08
24	0.07
25	0.06
26	0.04
27	0.04
28	0.04
29	0.04
30	0.04
31	0.04
32	0.05
33	0.1
34	0.1
35	0.11
36	0.11
37	0.12
38	0.12
39	0.18
40	0.23
41	0.2
42	0.25
43	0.28
44	0.28
45	0.29
46	0.3
47	0.28
48	0.23
49	0.21
50	0.16
51	0.13
52	0.13
53	0.11
54	0.09
55	0.07
56	0.07
57	0.07
58	0.06
59	0.09
60	0.1
61	0.1
62	0.1
63	0.11
64	0.12
65	0.12
66	0.12
67	0.11
68	0.13
69	0.12
70	0.14
71	0.16
72	0.18
73	0.19
74	0.21
75	0.21
76	0.19
77	0.24
78	0.23
79	0.22
80	0.21
81	0.21
82	0.2
83	0.22
84	0.22
85	0.16
86	0.16
87	0.15
88	0.12
89	0.11
90	0.12
91	0.09
92	0.09
93	0.11
94	0.11
95	0.1
96	0.12
97	0.12
98	0.11
99	0.11
100	0.1
101	0.09
102	0.1
103	0.09
104	0.08
105	0.09
106	0.11
107	0.12
108	0.15
109	0.18
110	0.18
111	0.19
112	0.19
113	0.18
114	0.15
115	0.15
116	0.13
117	0.12
118	0.11
119	0.12
120	0.14
121	0.14
122	0.15
123	0.15
124	0.15
125	0.15
126	0.2
127	0.2
128	0.25
129	0.25
130	0.27
131	0.27
132	0.25
133	0.23
134	0.19
135	0.17
136	0.11
137	0.1
138	0.07
139	0.08
140	0.1
141	0.1
142	0.1
143	0.09
144	0.08
145	0.09
146	0.09
147	0.11
148	0.09
149	0.08
150	0.1
151	0.09
152	0.09
153	0.09
154	0.08
155	0.06
156	0.07
157	0.08
158	0.06
159	0.07
160	0.07
161	0.08
162	0.09
163	0.09
164	0.07
165	0.07
166	0.08
167	0.1
168	0.1
169	0.1
170	0.11
171	0.11
172	0.12
173	0.12
174	0.11
175	0.09
176	0.09
177	0.08
178	0.07
179	0.07
180	0.07
181	0.08
182	0.1
183	0.08
184	0.08
185	0.09
186	0.1
187	0.1
188	0.15
189	0.17
190	0.2
191	0.23
192	0.27
193	0.27
194	0.26
195	0.26
196	0.24
197	0.23
198	0.19
199	0.16
200	0.14
201	0.12
202	0.12
203	0.12
204	0.1
205	0.09
206	0.09
207	0.09
208	0.08
209	0.09
210	0.09
211	0.09
212	0.06
213	0.06
214	0.08
215	0.08
216	0.08
217	0.07
218	0.07
219	0.07
220	0.07
221	0.07
222	0.06
223	0.05
224	0.05
225	0.05
226	0.05
227	0.04
228	0.05
229	0.04
230	0.04
231	0.04
232	0.04
233	0.05
234	0.05
235	0.05
236	0.05
237	0.05
238	0.06
239	0.06
240	0.05
241	0.05
242	0.05
243	0.05
244	0.05
245	0.04
246	0.04
247	0.04
248	0.05
249	0.05
250	0.06
251	0.06
252	0.07
253	0.09
254	0.11
255	0.11
256	0.11
257	0.15
258	0.16
259	0.18
260	0.18
261	0.2
262	0.19
263	0.19
264	0.19
265	0.15
266	0.15
267	0.12
268	0.11
269	0.08
270	0.07
271	0.07
272	0.06
273	0.05
274	0.05
275	0.05
276	0.05
277	0.04
278	0.03
279	0.04
280	0.06
281	0.08
282	0.08
283	0.09
284	0.1
285	0.19
286	0.2
287	0.2
288	0.2
289	0.21
290	0.23
291	0.25
292	0.24
293	0.18
294	0.19
295	0.22
296	0.21
297	0.18
298	0.16
299	0.13
300	0.13
301	0.1
302	0.08
303	0.05
304	0.06
305	0.06
306	0.06
307	0.06
308	0.06
309	0.07
310	0.07
311	0.08
312	0.08
313	0.08
314	0.1
315	0.1
316	0.1
317	0.1
318	0.11
319	0.1
320	0.1
321	0.09
322	0.08
323	0.08
324	0.09
325	0.09
326	0.08
327	0.08
328	0.06
329	0.06
330	0.06
331	0.06
332	0.05
333	0.05
334	0.06
335	0.06
336	0.06
337	0.06
338	0.08
339	0.08
340	0.08
341	0.09
342	0.07
343	0.08
344	0.09
345	0.1
346	0.11
347	0.11
348	0.12
349	0.13
350	0.14
351	0.13
352	0.13
353	0.12
354	0.09
355	0.1
356	0.09
357	0.09
358	0.11
359	0.11
360	0.12
361	0.11
362	0.12
363	0.12
364	0.12
365	0.12
366	0.1
367	0.09
368	0.09
369	0.09
370	0.09
371	0.08
372	0.08
373	0.14
374	0.14
375	0.15
376	0.16
377	0.17
378	0.17
379	0.2
380	0.21
381	0.19
382	0.23
383	0.23
384	0.23
385	0.24
386	0.22
387	0.2
388	0.2
389	0.22
390	0.19
391	0.17
392	0.16
393	0.15
394	0.15
395	0.15
396	0.13
397	0.07
398	0.09
399	0.08
400	0.09
401	0.1
402	0.12
403	0.14
404	0.14
405	0.15
406	0.15
407	0.16
408	0.19
409	0.22
410	0.23
411	0.26
412	0.27
413	0.26
414	0.26
415	0.25
416	0.24
417	0.24
418	0.2
419	0.16
420	0.18
421	0.18
422	0.18
423	0.21
424	0.21
425	0.19
426	0.19
427	0.23
428	0.28
429	0.28
430	0.28
431	0.26
432	0.26
433	0.26
434	0.3
435	0.32
436	0.28
437	0.34
438	0.32
439	0.33
440	0.33
441	0.34
442	0.32
443	0.3
444	0.32
445	0.27
446	0.28
447	0.28
448	0.25
449	0.22
450	0.19
451	0.14
452	0.09
453	0.07
454	0.06
455	0.09
456	0.09
457	0.1
458	0.11
459	0.11
460	0.12
461	0.19
462	0.25
463	0.25
464	0.33
465	0.36
466	0.4
467	0.42
468	0.47
469	0.44
470	0.41
471	0.42
472	0.37
473	0.34
474	0.29
475	0.26
476	0.21
477	0.17
478	0.14
479	0.09
480	0.07
481	0.06
482	0.06
483	0.07
484	0.07
485	0.07
486	0.07
487	0.08
488	0.12
489	0.16
490	0.18
491	0.19
492	0.23
493	0.23
494	0.31
495	0.37
496	0.38
497	0.41
498	0.5
499	0.59
500	0.67
501	0.77
502	0.79
503	0.82
504	0.88
505	0.91
506	0.92
507	0.92
508	0.92
509	0.91
510	0.88
511	0.86
512	0.84
513	0.81

G4MZU4

3D AlphaFold-predicted Structure Viewer