Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MRY2

Protein Details
Accession G4MRY2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-58MGKPAPPKGNRPTRNTQSQPKKQTQTTKTTKKQTPAPERPARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 3, cyto 3, plas 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
KEGG mgr:MGG_02469  -  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MHKPINRTGSFGGNVSMGKPAPPKGNRPTRNTQSQPKKQTQTTKTTKKQTPAPERPARSVDKPNTNLISLPDQQKMLNLFSQAFNAELTSPDFTNTLQAVKQGLFDRDFERVFGDEANLRVYAARYSPTRALGYAEVLSGIFEHLELLLPAETGPDEKTPAILNMVSIGGGAAEVAAFAAYLSQAPDRSGAVTLIDSGPWGAIVDSLASHVTTPPILPQWANAEAMANNRSLIEPARLAAKFLQKDVLSSELVGIFPDEGPCLVTLFFTLNELFTAGGIGKTTQFLLDVTAVIPSGSLLLVVDSPGSYSEATVGKEAKKYPMLWLLDKVLATAEDCTWQKMESQESRWFRLPEKLTYPIPLENMRFQMHLYRAKKPVFQAKSNSES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.22
4 0.16
5 0.18
6 0.21
7 0.24
8 0.31
9 0.36
10 0.44
11 0.51
12 0.62
13 0.67
14 0.71
15 0.77
16 0.76
17 0.82
18 0.81
19 0.82
20 0.82
21 0.84
22 0.86
23 0.85
24 0.84
25 0.81
26 0.84
27 0.81
28 0.81
29 0.81
30 0.82
31 0.82
32 0.84
33 0.82
34 0.79
35 0.79
36 0.79
37 0.8
38 0.79
39 0.8
40 0.8
41 0.78
42 0.76
43 0.74
44 0.69
45 0.65
46 0.65
47 0.63
48 0.63
49 0.61
50 0.63
51 0.58
52 0.53
53 0.48
54 0.41
55 0.38
56 0.34
57 0.35
58 0.3
59 0.29
60 0.28
61 0.3
62 0.3
63 0.26
64 0.23
65 0.2
66 0.19
67 0.19
68 0.2
69 0.17
70 0.15
71 0.13
72 0.11
73 0.1
74 0.09
75 0.11
76 0.11
77 0.11
78 0.11
79 0.12
80 0.11
81 0.14
82 0.14
83 0.14
84 0.12
85 0.13
86 0.14
87 0.14
88 0.18
89 0.17
90 0.19
91 0.19
92 0.2
93 0.21
94 0.23
95 0.23
96 0.2
97 0.18
98 0.16
99 0.16
100 0.14
101 0.14
102 0.11
103 0.12
104 0.13
105 0.11
106 0.11
107 0.11
108 0.11
109 0.1
110 0.09
111 0.12
112 0.11
113 0.15
114 0.18
115 0.2
116 0.2
117 0.19
118 0.2
119 0.18
120 0.19
121 0.16
122 0.13
123 0.1
124 0.09
125 0.09
126 0.07
127 0.06
128 0.04
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.1
149 0.08
150 0.08
151 0.07
152 0.07
153 0.06
154 0.05
155 0.05
156 0.03
157 0.03
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.03
170 0.04
171 0.05
172 0.05
173 0.06
174 0.06
175 0.07
176 0.07
177 0.07
178 0.06
179 0.06
180 0.07
181 0.06
182 0.06
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.05
200 0.05
201 0.06
202 0.07
203 0.08
204 0.07
205 0.08
206 0.12
207 0.13
208 0.14
209 0.12
210 0.12
211 0.12
212 0.14
213 0.14
214 0.1
215 0.09
216 0.09
217 0.09
218 0.09
219 0.1
220 0.09
221 0.08
222 0.08
223 0.13
224 0.13
225 0.14
226 0.17
227 0.22
228 0.21
229 0.22
230 0.26
231 0.21
232 0.22
233 0.22
234 0.21
235 0.15
236 0.14
237 0.14
238 0.1
239 0.1
240 0.09
241 0.08
242 0.06
243 0.06
244 0.06
245 0.06
246 0.05
247 0.06
248 0.06
249 0.06
250 0.06
251 0.05
252 0.06
253 0.07
254 0.07
255 0.08
256 0.08
257 0.07
258 0.07
259 0.08
260 0.07
261 0.06
262 0.06
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.07
269 0.07
270 0.06
271 0.07
272 0.07
273 0.08
274 0.08
275 0.08
276 0.07
277 0.08
278 0.07
279 0.07
280 0.06
281 0.05
282 0.04
283 0.04
284 0.04
285 0.03
286 0.04
287 0.04
288 0.04
289 0.05
290 0.04
291 0.05
292 0.05
293 0.07
294 0.06
295 0.06
296 0.1
297 0.12
298 0.13
299 0.15
300 0.18
301 0.19
302 0.23
303 0.25
304 0.27
305 0.29
306 0.29
307 0.32
308 0.37
309 0.38
310 0.37
311 0.38
312 0.36
313 0.34
314 0.33
315 0.28
316 0.21
317 0.17
318 0.16
319 0.14
320 0.11
321 0.14
322 0.15
323 0.17
324 0.17
325 0.17
326 0.19
327 0.21
328 0.29
329 0.29
330 0.35
331 0.42
332 0.47
333 0.52
334 0.56
335 0.55
336 0.49
337 0.52
338 0.51
339 0.49
340 0.5
341 0.5
342 0.45
343 0.47
344 0.48
345 0.41
346 0.41
347 0.39
348 0.37
349 0.36
350 0.39
351 0.37
352 0.34
353 0.32
354 0.35
355 0.36
356 0.42
357 0.41
358 0.45
359 0.51
360 0.55
361 0.59
362 0.59
363 0.63
364 0.61
365 0.64
366 0.65