Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MW65

Protein Details
Accession G4MW65    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-85AALAMMRKKRNNKGERKEVRESVHydrophilic
NLS Segment(s)
PositionSequence
69-79RKKRNNKGERK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
KEGG mgr:MGG_15776  -  
Amino Acid Sequences MPFILAYYRQIWPVSAGQIAPHEWSAKYVPHNGREQAQFAATRPPNPKGEKGNKSTQHLVWRAALAMMRKKRNNKGERKEVRESVCSHNSRSRPTITPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.16
5 0.18
6 0.18
7 0.16
8 0.15
9 0.14
10 0.13
11 0.15
12 0.16
13 0.17
14 0.19
15 0.26
16 0.3
17 0.33
18 0.38
19 0.37
20 0.4
21 0.38
22 0.37
23 0.29
24 0.26
25 0.22
26 0.18
27 0.26
28 0.21
29 0.25
30 0.26
31 0.29
32 0.33
33 0.35
34 0.39
35 0.39
36 0.47
37 0.48
38 0.5
39 0.56
40 0.55
41 0.57
42 0.56
43 0.5
44 0.48
45 0.44
46 0.41
47 0.33
48 0.28
49 0.24
50 0.21
51 0.2
52 0.16
53 0.21
54 0.27
55 0.33
56 0.39
57 0.47
58 0.56
59 0.64
60 0.71
61 0.74
62 0.77
63 0.81
64 0.85
65 0.85
66 0.83
67 0.79
68 0.74
69 0.68
70 0.63
71 0.59
72 0.59
73 0.54
74 0.51
75 0.53
76 0.52
77 0.54
78 0.54
79 0.52