Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4NDI2

Protein Details
Accession G4NDI2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-58VQWFVRWRRRGTRRPDKKETPPPVAHydrophilic
NLS Segment(s)
PositionSequence
41-51RRRGTRRPDKK
Subcellular Location(s) mito 10, nucl 9, cyto 5.5, cyto_pero 4
Family & Domain DBs
KEGG mgr:MGG_17490  -  
Amino Acid Sequences MSGTTHIHARGSTVSSGSWDEPRQKPVAPSVRHVQWFVRWRRRGTRRPDKKETPPPVALHLSFLLGAGPTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.17
5 0.19
6 0.19
7 0.26
8 0.28
9 0.31
10 0.32
11 0.31
12 0.3
13 0.35
14 0.41
15 0.36
16 0.37
17 0.38
18 0.41
19 0.41
20 0.4
21 0.32
22 0.3
23 0.37
24 0.41
25 0.46
26 0.46
27 0.49
28 0.58
29 0.67
30 0.69
31 0.71
32 0.74
33 0.75
34 0.8
35 0.86
36 0.84
37 0.84
38 0.86
39 0.83
40 0.79
41 0.74
42 0.66
43 0.62
44 0.58
45 0.48
46 0.4
47 0.33
48 0.26
49 0.21
50 0.19
51 0.14
52 0.09