Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MMW3

Protein Details
Accession G4MMW3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-94PVEPPPRREKRGPPHKQQLCEGBasic
NLS Segment(s)
PositionSequence
78-84PRREKRG
Subcellular Location(s) mito 22, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
KEGG mgr:MGG_16016  -  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MGRFTCRNRQCASGGWFSRTMGIWIRQFRGGRYNAIVYSQECELCGWLGWLTLDRGSHIERVPYWLKKWAGVPVEPPPRREKRGPPHKQQLCEGCRRGLCQVGRRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.42
4 0.38
5 0.38
6 0.3
7 0.27
8 0.21
9 0.24
10 0.26
11 0.29
12 0.31
13 0.34
14 0.34
15 0.34
16 0.37
17 0.33
18 0.3
19 0.29
20 0.29
21 0.24
22 0.25
23 0.25
24 0.18
25 0.18
26 0.16
27 0.13
28 0.11
29 0.11
30 0.09
31 0.08
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.09
44 0.11
45 0.11
46 0.12
47 0.11
48 0.17
49 0.21
50 0.21
51 0.22
52 0.26
53 0.27
54 0.27
55 0.29
56 0.3
57 0.28
58 0.27
59 0.28
60 0.3
61 0.41
62 0.4
63 0.41
64 0.44
65 0.48
66 0.53
67 0.57
68 0.58
69 0.59
70 0.69
71 0.76
72 0.78
73 0.82
74 0.83
75 0.8
76 0.78
77 0.76
78 0.72
79 0.72
80 0.65
81 0.6
82 0.55
83 0.54
84 0.5
85 0.47
86 0.47
87 0.47