Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179TYV8

Protein Details
Accession A0A179TYV8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-30ISSMNHPTQKEERRRRLKIKSENVGKPAHydrophilic
NLS Segment(s)
PositionSequence
15-20RRRRLK
Subcellular Location(s) nucl 17, mito_nucl 12.333, cyto_nucl 9.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MRISSMNHPTQKEERRRRLKIKSENVGKPAPLTTRVLYWTKLYQIIYPTMSTQRNSSMPTLLRTIMPRYSQTTPIPSCAEKPIPFPFHSSQPQLHPWLHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.84
4 0.87
5 0.88
6 0.89
7 0.88
8 0.87
9 0.87
10 0.85
11 0.81
12 0.76
13 0.68
14 0.58
15 0.48
16 0.4
17 0.32
18 0.25
19 0.23
20 0.19
21 0.18
22 0.22
23 0.22
24 0.21
25 0.21
26 0.2
27 0.19
28 0.21
29 0.2
30 0.18
31 0.18
32 0.18
33 0.17
34 0.16
35 0.15
36 0.17
37 0.18
38 0.17
39 0.16
40 0.17
41 0.18
42 0.19
43 0.19
44 0.18
45 0.18
46 0.19
47 0.2
48 0.18
49 0.18
50 0.18
51 0.2
52 0.2
53 0.2
54 0.21
55 0.24
56 0.26
57 0.29
58 0.3
59 0.34
60 0.32
61 0.34
62 0.35
63 0.31
64 0.31
65 0.32
66 0.36
67 0.29
68 0.33
69 0.37
70 0.39
71 0.39
72 0.43
73 0.41
74 0.42
75 0.47
76 0.47
77 0.43
78 0.44
79 0.49
80 0.48