Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N7X8

Protein Details
Accession G4N7X8   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-23GVTNKKTITKTRRKTRDVDQIKHydrophilic
63-88YSLVEHRKGKPHKRRVKQLQEEPYTQHydrophilic
NLS Segment(s)
PositionSequence
69-78RKGKPHKRRV
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mgr:MGG_03520  -  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGVTNKKTITKTRRKTRDVDQIKADLLSPKHLAQWKDTKASEDLPGLGRHYCIECAKWFETDYSLVEHRKGKPHKRRVKQLQEEPYTQKEAEAAIGLRTDNKGPQPRGDADVDMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.8
4 0.81
5 0.77
6 0.73
7 0.67
8 0.59
9 0.55
10 0.49
11 0.4
12 0.34
13 0.27
14 0.25
15 0.22
16 0.2
17 0.24
18 0.28
19 0.28
20 0.29
21 0.37
22 0.37
23 0.41
24 0.4
25 0.38
26 0.35
27 0.36
28 0.32
29 0.24
30 0.21
31 0.17
32 0.18
33 0.16
34 0.14
35 0.13
36 0.11
37 0.11
38 0.12
39 0.11
40 0.12
41 0.12
42 0.16
43 0.16
44 0.16
45 0.16
46 0.14
47 0.15
48 0.14
49 0.14
50 0.12
51 0.13
52 0.13
53 0.16
54 0.2
55 0.21
56 0.29
57 0.37
58 0.45
59 0.54
60 0.64
61 0.72
62 0.77
63 0.86
64 0.88
65 0.9
66 0.9
67 0.89
68 0.88
69 0.82
70 0.78
71 0.72
72 0.64
73 0.56
74 0.46
75 0.37
76 0.27
77 0.22
78 0.18
79 0.15
80 0.12
81 0.09
82 0.1
83 0.1
84 0.11
85 0.13
86 0.14
87 0.16
88 0.23
89 0.32
90 0.34
91 0.39
92 0.44
93 0.45
94 0.48
95 0.47