Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NLT2

Protein Details
Accession G4NLT2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-96ALGPSRRRRKGARRRARKPKNNKISCSPHPBasic
NLS Segment(s)
PositionSequence
70-87PSRRRRKGARRRARKPKN
Subcellular Location(s) plas 10extr 10, E.R. 2, vacu 2, mito 1, cyto 1, pero 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
KEGG mgr:MGG_12582  -  
Amino Acid Sequences MRIPGITTAAATVAALAVLGHGLAVPEASISASTFADPQAAGLAFTEQPATSNSTITELVTRGELAALGPSRRRRKGARRRARKPKNNKISCSPHPCALDCNSIFTLVTLGVACALCHIITDCPPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.02
8 0.02
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.04
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.08
31 0.07
32 0.08
33 0.08
34 0.06
35 0.07
36 0.08
37 0.11
38 0.1
39 0.1
40 0.1
41 0.12
42 0.12
43 0.12
44 0.11
45 0.08
46 0.08
47 0.08
48 0.08
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.06
55 0.07
56 0.11
57 0.19
58 0.26
59 0.29
60 0.34
61 0.4
62 0.51
63 0.61
64 0.69
65 0.72
66 0.76
67 0.84
68 0.91
69 0.94
70 0.93
71 0.93
72 0.93
73 0.93
74 0.91
75 0.85
76 0.83
77 0.81
78 0.8
79 0.78
80 0.69
81 0.64
82 0.58
83 0.54
84 0.48
85 0.43
86 0.42
87 0.33
88 0.35
89 0.29
90 0.27
91 0.26
92 0.22
93 0.2
94 0.11
95 0.12
96 0.07
97 0.06
98 0.08
99 0.08
100 0.07
101 0.07
102 0.08
103 0.07
104 0.08
105 0.1
106 0.1