Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4NGC2

Protein Details
Accession G4NGC2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-68FIECRRKDAHCKPHTIRRKLBasic
NLS Segment(s)
Subcellular Location(s) plas 23, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_10429  -  
Amino Acid Sequences MFFEQANCTTVPENIASNAGISGIGVILSFVITALLAIGMSSSLILQEFIECRRKDAHCKPHTIRRKLLSSYSDQQILQGIGLQSVGLALTARLSPYHFFLIWMLSLLSMAVHNTTLLALVHDFRRDWLLRWLRQFLMFVNLILSSVYGAYILRRISHNIEPTLPIACVWDAGAPLAKSTPENPIASYIGTGAVIVGNIVVFALATWYLHSRGQRFYKIVQVVGSVFMAAVGIGAIVRVILISQAFGDPNVPMADSGEKEWSFGQLLSVLLLILPVISILEIYRGELNVAPPVDDRSYLDLRKSSSGVEEGNEMQSSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.14
5 0.13
6 0.11
7 0.09
8 0.07
9 0.06
10 0.05
11 0.05
12 0.04
13 0.04
14 0.03
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.05
33 0.05
34 0.07
35 0.09
36 0.14
37 0.23
38 0.22
39 0.25
40 0.31
41 0.35
42 0.43
43 0.52
44 0.58
45 0.57
46 0.67
47 0.7
48 0.74
49 0.81
50 0.78
51 0.75
52 0.72
53 0.72
54 0.65
55 0.65
56 0.59
57 0.56
58 0.55
59 0.5
60 0.46
61 0.38
62 0.35
63 0.31
64 0.27
65 0.19
66 0.16
67 0.13
68 0.1
69 0.1
70 0.09
71 0.06
72 0.06
73 0.06
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.05
80 0.05
81 0.07
82 0.08
83 0.11
84 0.13
85 0.12
86 0.13
87 0.13
88 0.14
89 0.12
90 0.12
91 0.09
92 0.06
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.04
105 0.05
106 0.05
107 0.06
108 0.08
109 0.09
110 0.09
111 0.09
112 0.14
113 0.14
114 0.15
115 0.23
116 0.3
117 0.33
118 0.36
119 0.39
120 0.35
121 0.35
122 0.34
123 0.25
124 0.22
125 0.18
126 0.14
127 0.12
128 0.11
129 0.1
130 0.09
131 0.08
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.06
139 0.06
140 0.07
141 0.08
142 0.1
143 0.14
144 0.18
145 0.21
146 0.2
147 0.2
148 0.2
149 0.2
150 0.19
151 0.14
152 0.11
153 0.08
154 0.07
155 0.07
156 0.06
157 0.06
158 0.05
159 0.05
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.08
167 0.12
168 0.14
169 0.14
170 0.14
171 0.16
172 0.17
173 0.16
174 0.15
175 0.11
176 0.08
177 0.07
178 0.07
179 0.04
180 0.04
181 0.04
182 0.03
183 0.03
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.03
192 0.03
193 0.04
194 0.05
195 0.07
196 0.1
197 0.13
198 0.15
199 0.22
200 0.27
201 0.3
202 0.31
203 0.31
204 0.37
205 0.36
206 0.34
207 0.28
208 0.25
209 0.21
210 0.19
211 0.18
212 0.1
213 0.08
214 0.06
215 0.06
216 0.04
217 0.03
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.03
228 0.03
229 0.03
230 0.04
231 0.05
232 0.06
233 0.06
234 0.07
235 0.06
236 0.08
237 0.08
238 0.08
239 0.07
240 0.09
241 0.11
242 0.11
243 0.13
244 0.17
245 0.17
246 0.18
247 0.18
248 0.18
249 0.17
250 0.16
251 0.15
252 0.11
253 0.11
254 0.1
255 0.1
256 0.08
257 0.06
258 0.06
259 0.05
260 0.03
261 0.03
262 0.02
263 0.02
264 0.02
265 0.03
266 0.03
267 0.06
268 0.06
269 0.08
270 0.09
271 0.09
272 0.11
273 0.12
274 0.14
275 0.16
276 0.17
277 0.16
278 0.16
279 0.2
280 0.2
281 0.2
282 0.21
283 0.22
284 0.28
285 0.29
286 0.33
287 0.32
288 0.34
289 0.36
290 0.35
291 0.3
292 0.27
293 0.28
294 0.25
295 0.23
296 0.24
297 0.22
298 0.24
299 0.22
300 0.19