Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N3S5

Protein Details
Accession G4N3S5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-72YRRAHLVPSKGKRTKKKSKKQASDGQTPGHydrophilic
NLS Segment(s)
PositionSequence
51-64PSKGKRTKKKSKKQ
Subcellular Location(s) nucl 16.5, mito_nucl 11.666, cyto_nucl 11.333, mito 5.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
KEGG mgr:MGG_05001  -  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MERKRLLHHLDTPFSAVQWPHVLPEDQDTVLELLCSLLSPLGDYRRAHLVPSKGKRTKKKSKKQASDGQTPGSERPRPPPPELSAFVDVGLASITRCLQQDSESSVISSSGDQQSPENLKGTPYAMILVARSGHSSAFHSHFPQMVAMASKSHPDQPAIRLVGFSKSCEDRLSDCLGVPRVSSVALRPGAPLSKPLIEFVRQHVPVIEIPWVKEVVDGYQETKIKTVEAPIGRKKQKVTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.26
4 0.22
5 0.22
6 0.21
7 0.19
8 0.22
9 0.22
10 0.2
11 0.24
12 0.24
13 0.2
14 0.2
15 0.19
16 0.16
17 0.15
18 0.14
19 0.09
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.09
28 0.13
29 0.18
30 0.18
31 0.21
32 0.28
33 0.28
34 0.28
35 0.32
36 0.36
37 0.41
38 0.49
39 0.57
40 0.57
41 0.66
42 0.75
43 0.79
44 0.83
45 0.84
46 0.86
47 0.87
48 0.9
49 0.92
50 0.91
51 0.91
52 0.87
53 0.86
54 0.77
55 0.69
56 0.6
57 0.51
58 0.45
59 0.41
60 0.38
61 0.3
62 0.34
63 0.39
64 0.42
65 0.45
66 0.47
67 0.45
68 0.47
69 0.48
70 0.47
71 0.4
72 0.35
73 0.31
74 0.25
75 0.21
76 0.14
77 0.11
78 0.06
79 0.04
80 0.04
81 0.04
82 0.06
83 0.06
84 0.07
85 0.07
86 0.09
87 0.11
88 0.14
89 0.16
90 0.14
91 0.14
92 0.13
93 0.13
94 0.12
95 0.1
96 0.09
97 0.09
98 0.1
99 0.1
100 0.1
101 0.14
102 0.16
103 0.17
104 0.15
105 0.13
106 0.13
107 0.13
108 0.14
109 0.11
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.08
123 0.11
124 0.13
125 0.14
126 0.15
127 0.16
128 0.16
129 0.16
130 0.15
131 0.12
132 0.1
133 0.1
134 0.09
135 0.09
136 0.09
137 0.1
138 0.11
139 0.14
140 0.15
141 0.16
142 0.17
143 0.18
144 0.25
145 0.25
146 0.24
147 0.21
148 0.21
149 0.24
150 0.23
151 0.21
152 0.19
153 0.19
154 0.2
155 0.2
156 0.21
157 0.18
158 0.21
159 0.24
160 0.21
161 0.2
162 0.23
163 0.24
164 0.22
165 0.2
166 0.17
167 0.13
168 0.13
169 0.13
170 0.1
171 0.14
172 0.15
173 0.16
174 0.16
175 0.18
176 0.19
177 0.19
178 0.2
179 0.18
180 0.21
181 0.21
182 0.22
183 0.23
184 0.25
185 0.26
186 0.29
187 0.35
188 0.31
189 0.31
190 0.3
191 0.29
192 0.27
193 0.27
194 0.28
195 0.2
196 0.2
197 0.22
198 0.22
199 0.19
200 0.19
201 0.18
202 0.13
203 0.16
204 0.16
205 0.16
206 0.23
207 0.25
208 0.24
209 0.26
210 0.24
211 0.21
212 0.21
213 0.23
214 0.25
215 0.3
216 0.38
217 0.45
218 0.55
219 0.59
220 0.63
221 0.64