Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N753

Protein Details
Accession G4N753    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVKPLTFKGDKKPKKRKRTAADDNNDDAPHydrophilic
NLS Segment(s)
PositionSequence
9-18GDKKPKKRKR
225-245RFKPRIKVSKEEKARERISRR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
KEGG mgr:MGG_03612  -  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKKPKKRKRTAADDNNDDAPSSRQAATGSAAASEPVDEEAIANDDSWVSAEAVNDVSGPVMFVLPTEPPSALACDAAGKVFTLPIENIVDGNPASAEPHDVRQVFVANKIVGTENYRFKGHHGKYLGCDKMGILSATSDAVSPLECFVLIATPDTPGTFQVQTLRETFIAVKEPKARAAGASASSSKSAKAAAPEVRGDASDITFETTLRIRMQARFKPRIKVSKEEKARERISRRELEEAVGRRLEDDEVRLLKRARREGDYHEKLLNLKIKSKHDKYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.94
3 0.93
4 0.93
5 0.94
6 0.94
7 0.94
8 0.93
9 0.88
10 0.81
11 0.74
12 0.63
13 0.52
14 0.42
15 0.34
16 0.27
17 0.23
18 0.2
19 0.17
20 0.18
21 0.19
22 0.2
23 0.19
24 0.16
25 0.13
26 0.13
27 0.12
28 0.11
29 0.1
30 0.08
31 0.07
32 0.07
33 0.06
34 0.06
35 0.07
36 0.09
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.07
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.05
60 0.06
61 0.08
62 0.09
63 0.08
64 0.1
65 0.11
66 0.12
67 0.11
68 0.11
69 0.09
70 0.09
71 0.1
72 0.09
73 0.08
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.08
87 0.08
88 0.06
89 0.05
90 0.06
91 0.05
92 0.08
93 0.08
94 0.1
95 0.15
96 0.15
97 0.15
98 0.15
99 0.19
100 0.16
101 0.17
102 0.18
103 0.13
104 0.13
105 0.14
106 0.14
107 0.11
108 0.14
109 0.16
110 0.18
111 0.2
112 0.21
113 0.2
114 0.22
115 0.32
116 0.3
117 0.32
118 0.3
119 0.3
120 0.32
121 0.4
122 0.38
123 0.27
124 0.26
125 0.2
126 0.18
127 0.18
128 0.14
129 0.07
130 0.06
131 0.06
132 0.06
133 0.07
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.09
154 0.08
155 0.09
156 0.13
157 0.15
158 0.17
159 0.18
160 0.19
161 0.16
162 0.17
163 0.17
164 0.13
165 0.18
166 0.17
167 0.19
168 0.23
169 0.24
170 0.25
171 0.26
172 0.24
173 0.18
174 0.2
175 0.18
176 0.14
177 0.16
178 0.15
179 0.14
180 0.16
181 0.16
182 0.14
183 0.12
184 0.12
185 0.11
186 0.12
187 0.17
188 0.2
189 0.22
190 0.23
191 0.23
192 0.22
193 0.21
194 0.2
195 0.15
196 0.11
197 0.09
198 0.08
199 0.09
200 0.09
201 0.09
202 0.1
203 0.1
204 0.12
205 0.12
206 0.16
207 0.17
208 0.23
209 0.32
210 0.37
211 0.46
212 0.53
213 0.56
214 0.62
215 0.67
216 0.71
217 0.67
218 0.7
219 0.69
220 0.69
221 0.75
222 0.75
223 0.74
224 0.73
225 0.74
226 0.74
227 0.73
228 0.71
229 0.7
230 0.69
231 0.66
232 0.63
233 0.58
234 0.52
235 0.52
236 0.47
237 0.43
238 0.37
239 0.33
240 0.27
241 0.27
242 0.26
243 0.2
244 0.19
245 0.21
246 0.24
247 0.26
248 0.29
249 0.32
250 0.34
251 0.41
252 0.47
253 0.45
254 0.47
255 0.5
256 0.55
257 0.63
258 0.65
259 0.61
260 0.54
261 0.51
262 0.46
263 0.49
264 0.47
265 0.39
266 0.4
267 0.43
268 0.51
269 0.6