Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GH55

Protein Details
Accession C5GH55    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-31NRCSLSPKLPQERHPNRPHPAHydrophilic
174-202GKVFTPATSAKPRKRRRRRGYTGDPPDSQHydrophilic
NLS Segment(s)
PositionSequence
136-145RLRIRGRKRK
183-192AKPRKRRRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MVLNESPLRGNRCSLSPKLPQERHPNRPHPAAFASENPSNTARFPNDCTIVHSVDGHGDTLVVEDISAHDAGYDGDIEIVAPCEYEEAESRPSTPQQAIHRSRNDVGTDDIAKTGLIDAMRALDCDSDITDYGYRRLRIRGRKRKGGDFFSGQSTIDCSSDAESIEIVDLEHYGKVFTPATSAKPRKRRRRRGYTGDPPDSQNAEMSSVDGDFPTHVPYGINLNGDTFPSQEDEMDIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.46
4 0.54
5 0.62
6 0.65
7 0.67
8 0.72
9 0.77
10 0.8
11 0.81
12 0.8
13 0.76
14 0.8
15 0.73
16 0.67
17 0.6
18 0.54
19 0.47
20 0.43
21 0.42
22 0.36
23 0.36
24 0.33
25 0.32
26 0.28
27 0.26
28 0.27
29 0.24
30 0.23
31 0.28
32 0.3
33 0.33
34 0.32
35 0.35
36 0.34
37 0.32
38 0.3
39 0.25
40 0.2
41 0.18
42 0.18
43 0.14
44 0.1
45 0.09
46 0.08
47 0.08
48 0.08
49 0.05
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.07
74 0.08
75 0.11
76 0.11
77 0.12
78 0.14
79 0.15
80 0.16
81 0.16
82 0.19
83 0.23
84 0.33
85 0.38
86 0.44
87 0.46
88 0.47
89 0.48
90 0.45
91 0.39
92 0.31
93 0.25
94 0.2
95 0.18
96 0.15
97 0.14
98 0.11
99 0.1
100 0.08
101 0.07
102 0.06
103 0.05
104 0.05
105 0.04
106 0.06
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.06
114 0.05
115 0.05
116 0.06
117 0.08
118 0.08
119 0.12
120 0.15
121 0.16
122 0.17
123 0.23
124 0.3
125 0.39
126 0.5
127 0.57
128 0.62
129 0.7
130 0.74
131 0.77
132 0.76
133 0.71
134 0.65
135 0.58
136 0.52
137 0.45
138 0.41
139 0.32
140 0.25
141 0.21
142 0.17
143 0.13
144 0.11
145 0.08
146 0.09
147 0.1
148 0.1
149 0.09
150 0.07
151 0.07
152 0.07
153 0.07
154 0.05
155 0.04
156 0.04
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.08
163 0.09
164 0.08
165 0.11
166 0.13
167 0.18
168 0.29
169 0.37
170 0.44
171 0.54
172 0.64
173 0.72
174 0.82
175 0.88
176 0.89
177 0.92
178 0.94
179 0.94
180 0.94
181 0.94
182 0.93
183 0.88
184 0.79
185 0.71
186 0.64
187 0.56
188 0.45
189 0.36
190 0.26
191 0.22
192 0.2
193 0.17
194 0.14
195 0.12
196 0.12
197 0.09
198 0.09
199 0.08
200 0.09
201 0.11
202 0.1
203 0.1
204 0.11
205 0.12
206 0.17
207 0.18
208 0.19
209 0.17
210 0.19
211 0.19
212 0.2
213 0.2
214 0.15
215 0.13
216 0.14
217 0.15
218 0.13