Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MY41

Protein Details
Accession G4MY41   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
114-133DEFSKSKKQRRLAAKKQRALHydrophilic
179-201ALRSAMRKERKAKIRENNYLRSMHydrophilic
NLS Segment(s)
PositionSequence
119-129SKKQRRLAAKK
186-189KERK
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mgr:MGG_11244  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MICRTCLRQAARLPSRTLPTARSFTTTLRPLNAAAAAPSPVADAPAAEAPADAVANQTKSLSSCPKGTILKGLNYFKDKSDPVALADDAYPAWLWDCLSVTKKAAAVDADSGADEFSKSKKQRRLAAKKQRALEAQLLASGDLSALAPKIPVQQQSINLPSAEDGSVESAVGAAETREALRSAMRKERKAKIRENNYLRSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.56
4 0.51
5 0.45
6 0.43
7 0.43
8 0.4
9 0.39
10 0.36
11 0.34
12 0.4
13 0.4
14 0.36
15 0.34
16 0.34
17 0.3
18 0.3
19 0.28
20 0.2
21 0.15
22 0.14
23 0.12
24 0.11
25 0.1
26 0.09
27 0.08
28 0.08
29 0.07
30 0.06
31 0.07
32 0.08
33 0.09
34 0.08
35 0.08
36 0.07
37 0.08
38 0.07
39 0.05
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.13
48 0.18
49 0.18
50 0.2
51 0.21
52 0.26
53 0.27
54 0.27
55 0.31
56 0.28
57 0.3
58 0.34
59 0.35
60 0.33
61 0.35
62 0.36
63 0.29
64 0.3
65 0.26
66 0.22
67 0.23
68 0.2
69 0.18
70 0.19
71 0.18
72 0.14
73 0.14
74 0.11
75 0.08
76 0.08
77 0.06
78 0.04
79 0.05
80 0.04
81 0.04
82 0.04
83 0.05
84 0.07
85 0.09
86 0.1
87 0.11
88 0.11
89 0.12
90 0.12
91 0.12
92 0.11
93 0.09
94 0.09
95 0.09
96 0.08
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.06
104 0.14
105 0.18
106 0.26
107 0.34
108 0.4
109 0.48
110 0.59
111 0.68
112 0.71
113 0.79
114 0.81
115 0.8
116 0.77
117 0.73
118 0.64
119 0.57
120 0.5
121 0.4
122 0.3
123 0.26
124 0.23
125 0.17
126 0.15
127 0.11
128 0.07
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.1
137 0.13
138 0.16
139 0.2
140 0.23
141 0.26
142 0.32
143 0.34
144 0.31
145 0.28
146 0.25
147 0.21
148 0.19
149 0.16
150 0.11
151 0.08
152 0.09
153 0.09
154 0.09
155 0.08
156 0.06
157 0.06
158 0.06
159 0.05
160 0.03
161 0.04
162 0.05
163 0.06
164 0.07
165 0.08
166 0.08
167 0.13
168 0.18
169 0.24
170 0.33
171 0.41
172 0.48
173 0.56
174 0.66
175 0.71
176 0.74
177 0.79
178 0.8
179 0.82
180 0.85
181 0.85