Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NEX0

Protein Details
Accession G4NEX0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
116-142WPGQAHWKRKHKAAKRKNRNCNCLANLHydrophilic
NLS Segment(s)
PositionSequence
122-133WKRKHKAAKRKN
Subcellular Location(s) mito 7.5, cyto_mito 6.5, plas 6, cyto 4.5, nucl 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_00725  -  
Amino Acid Sequences MTLDNTTEKGGLAPPKAAITSETTKILEKVSTDTLSPESIAMGGRGGRNGGSSGLSTPTSVTGAALNPFDTDIEAQSKMHTTDTREQTRHFLGRSSTNLARGESHAAGSNDDCQVWPGQAHWKRKHKAAKRKNRNCNCLANLSCRNRMIVKIFIGLFIIATAVGVGFGISKPLGAPIWKPSNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.22
5 0.18
6 0.2
7 0.22
8 0.23
9 0.25
10 0.24
11 0.26
12 0.26
13 0.26
14 0.21
15 0.17
16 0.19
17 0.2
18 0.2
19 0.19
20 0.2
21 0.2
22 0.19
23 0.18
24 0.14
25 0.1
26 0.1
27 0.09
28 0.08
29 0.07
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.09
38 0.08
39 0.08
40 0.09
41 0.11
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.08
49 0.07
50 0.08
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.08
61 0.09
62 0.08
63 0.09
64 0.1
65 0.1
66 0.12
67 0.12
68 0.14
69 0.22
70 0.3
71 0.35
72 0.36
73 0.36
74 0.38
75 0.4
76 0.37
77 0.29
78 0.24
79 0.19
80 0.22
81 0.23
82 0.25
83 0.23
84 0.24
85 0.25
86 0.23
87 0.22
88 0.2
89 0.21
90 0.16
91 0.15
92 0.15
93 0.14
94 0.15
95 0.14
96 0.15
97 0.12
98 0.12
99 0.11
100 0.09
101 0.09
102 0.08
103 0.08
104 0.07
105 0.17
106 0.24
107 0.33
108 0.42
109 0.51
110 0.54
111 0.63
112 0.72
113 0.72
114 0.76
115 0.78
116 0.81
117 0.82
118 0.9
119 0.93
120 0.92
121 0.9
122 0.85
123 0.83
124 0.75
125 0.72
126 0.64
127 0.61
128 0.61
129 0.58
130 0.57
131 0.49
132 0.47
133 0.4
134 0.41
135 0.37
136 0.32
137 0.29
138 0.28
139 0.28
140 0.25
141 0.24
142 0.2
143 0.16
144 0.11
145 0.09
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.06
156 0.06
157 0.06
158 0.06
159 0.09
160 0.11
161 0.12
162 0.14
163 0.21