Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4NC04

Protein Details
Accession G4NC04    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
180-199KMSGRKGSYKKMMAQRYKKRBasic
NLS Segment(s)
PositionSequence
183-199GRKGSYKKMMAQRYKKR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG mgr:MGG_00473  -  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MAAGDVALSENQLIESLLADAEKRLSAQAASQDVAVTGSKPASLVKIPKVLATTKSSSKKEEELSVRSVAPIQPKNKTEDAGSDWFNMPKTNATPELVRDLKLLRMRNVLNPKQFFKKDTRTQLVPTYCQSGTIIEGPTEFYNARINRKERKKTLAEEVLASSDAMAKFKTKYSDIQTRKMSGRKGSYKKMMAQRYKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.07
8 0.08
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.11
15 0.16
16 0.18
17 0.18
18 0.17
19 0.17
20 0.16
21 0.17
22 0.14
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.08
29 0.1
30 0.14
31 0.17
32 0.2
33 0.26
34 0.26
35 0.27
36 0.29
37 0.29
38 0.29
39 0.29
40 0.29
41 0.32
42 0.4
43 0.4
44 0.41
45 0.42
46 0.43
47 0.4
48 0.43
49 0.4
50 0.36
51 0.37
52 0.36
53 0.32
54 0.28
55 0.27
56 0.21
57 0.24
58 0.26
59 0.26
60 0.31
61 0.32
62 0.37
63 0.37
64 0.36
65 0.29
66 0.26
67 0.28
68 0.25
69 0.24
70 0.21
71 0.21
72 0.2
73 0.2
74 0.17
75 0.13
76 0.12
77 0.12
78 0.13
79 0.13
80 0.14
81 0.14
82 0.15
83 0.2
84 0.19
85 0.18
86 0.16
87 0.15
88 0.18
89 0.22
90 0.23
91 0.19
92 0.23
93 0.23
94 0.29
95 0.38
96 0.39
97 0.41
98 0.42
99 0.43
100 0.46
101 0.46
102 0.43
103 0.41
104 0.45
105 0.47
106 0.52
107 0.55
108 0.5
109 0.52
110 0.56
111 0.51
112 0.44
113 0.37
114 0.33
115 0.28
116 0.26
117 0.23
118 0.17
119 0.16
120 0.16
121 0.15
122 0.1
123 0.11
124 0.12
125 0.12
126 0.13
127 0.11
128 0.1
129 0.17
130 0.19
131 0.26
132 0.31
133 0.37
134 0.45
135 0.56
136 0.65
137 0.63
138 0.69
139 0.69
140 0.67
141 0.71
142 0.69
143 0.6
144 0.52
145 0.47
146 0.4
147 0.34
148 0.28
149 0.18
150 0.14
151 0.13
152 0.12
153 0.12
154 0.12
155 0.13
156 0.17
157 0.21
158 0.2
159 0.26
160 0.33
161 0.44
162 0.47
163 0.55
164 0.57
165 0.58
166 0.63
167 0.62
168 0.6
169 0.57
170 0.62
171 0.64
172 0.67
173 0.7
174 0.73
175 0.73
176 0.76
177 0.77
178 0.77
179 0.78