Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N9C5

Protein Details
Accession G4N9C5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
108-127YRYFKKYPGVRLPNRTWKGKHydrophilic
NLS Segment(s)
PositionSequence
121-132NRTWKGKGKRPE
Subcellular Location(s) extr 19, mito 6
Family & Domain DBs
KEGG mgr:MGG_10020  -  
Amino Acid Sequences MHAFKFVQIWALLAIGAAAIPTPINLPAALTSQLEPRAEGGASAGDANNIQPQSQEKSPFICVWCGKDKGGSSALIGHEIHNHQDDEMVAWTGRDRRLNKYETDKEGYRYFKKYPGVRLPNRTWKGKGKRPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.06
12 0.06
13 0.07
14 0.08
15 0.1
16 0.11
17 0.11
18 0.12
19 0.14
20 0.17
21 0.17
22 0.16
23 0.15
24 0.15
25 0.13
26 0.12
27 0.1
28 0.07
29 0.07
30 0.07
31 0.06
32 0.05
33 0.05
34 0.06
35 0.09
36 0.08
37 0.08
38 0.08
39 0.11
40 0.15
41 0.18
42 0.2
43 0.18
44 0.2
45 0.23
46 0.24
47 0.22
48 0.22
49 0.2
50 0.21
51 0.25
52 0.24
53 0.22
54 0.22
55 0.22
56 0.21
57 0.21
58 0.17
59 0.13
60 0.15
61 0.15
62 0.14
63 0.14
64 0.12
65 0.13
66 0.13
67 0.15
68 0.13
69 0.13
70 0.11
71 0.11
72 0.11
73 0.1
74 0.1
75 0.09
76 0.08
77 0.07
78 0.09
79 0.12
80 0.16
81 0.21
82 0.23
83 0.3
84 0.37
85 0.4
86 0.44
87 0.5
88 0.54
89 0.53
90 0.57
91 0.52
92 0.49
93 0.53
94 0.54
95 0.49
96 0.47
97 0.44
98 0.44
99 0.5
100 0.51
101 0.55
102 0.59
103 0.65
104 0.68
105 0.74
106 0.77
107 0.8
108 0.8
109 0.76
110 0.72
111 0.72
112 0.74