Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N7G3

Protein Details
Accession G4N7G3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-127GMVALKPRDKSKKKAKAKKRKGGAVTGKABasic
NLS Segment(s)
PositionSequence
104-127KPRDKSKKKAKAKKRKGGAVTGKA
Subcellular Location(s) cyto 13, cyto_nucl 12, nucl 9, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG mgr:MGG_03572  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MGRVTNEEFFIKLAELFAARKGDDHGQIHLTQKRLSHDAPQSSDPDADLHPEKPLPIVVRASNGKGRGAKKEKLSLSTTVDPEGLDSFYARYAEVCKAGMVALKPRDKSKKKAKAKKRKGGAVTGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.13
5 0.14
6 0.14
7 0.14
8 0.17
9 0.2
10 0.25
11 0.26
12 0.25
13 0.25
14 0.28
15 0.33
16 0.34
17 0.32
18 0.28
19 0.29
20 0.3
21 0.32
22 0.31
23 0.32
24 0.35
25 0.38
26 0.39
27 0.39
28 0.37
29 0.34
30 0.32
31 0.25
32 0.2
33 0.15
34 0.15
35 0.15
36 0.13
37 0.13
38 0.13
39 0.13
40 0.12
41 0.13
42 0.11
43 0.11
44 0.13
45 0.12
46 0.16
47 0.17
48 0.19
49 0.19
50 0.19
51 0.19
52 0.22
53 0.23
54 0.29
55 0.34
56 0.36
57 0.37
58 0.44
59 0.43
60 0.42
61 0.43
62 0.37
63 0.37
64 0.36
65 0.33
66 0.27
67 0.26
68 0.21
69 0.19
70 0.17
71 0.11
72 0.07
73 0.07
74 0.06
75 0.07
76 0.08
77 0.07
78 0.07
79 0.09
80 0.11
81 0.12
82 0.12
83 0.11
84 0.11
85 0.11
86 0.13
87 0.12
88 0.18
89 0.24
90 0.28
91 0.31
92 0.39
93 0.49
94 0.53
95 0.62
96 0.66
97 0.7
98 0.76
99 0.85
100 0.88
101 0.89
102 0.94
103 0.94
104 0.93
105 0.92
106 0.87
107 0.87