Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N9M4

Protein Details
Accession G4N9M4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
112-136AERKAQRKAEREAKRKAQRKAEREABasic
NLS Segment(s)
PositionSequence
101-136KIKAEREAEREAERKAQRKAEREAKRKAQRKAEREA
Subcellular Location(s) nucl 10.5, mito 9.5, cyto_nucl 8.833, cyto_mito 8.333, cyto 6
Family & Domain DBs
KEGG mgr:MGG_17256  -  
Amino Acid Sequences MRLQIITVATCFVYGALTNLAEAHNQKISARGVKNQTFGQCVDRCYATRFYGMDIPPTPSKFKDLYRHDAHMVFIDTLCHDHCAVIMEELQAIAIRKVEEKIKAEREAEREAERKAQRKAEREAKRKAQRKAEREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.11
9 0.12
10 0.13
11 0.14
12 0.14
13 0.14
14 0.18
15 0.21
16 0.27
17 0.28
18 0.32
19 0.38
20 0.41
21 0.44
22 0.43
23 0.42
24 0.37
25 0.36
26 0.36
27 0.3
28 0.28
29 0.26
30 0.25
31 0.23
32 0.25
33 0.27
34 0.21
35 0.22
36 0.2
37 0.2
38 0.24
39 0.23
40 0.23
41 0.21
42 0.23
43 0.23
44 0.25
45 0.25
46 0.19
47 0.23
48 0.21
49 0.25
50 0.31
51 0.34
52 0.4
53 0.42
54 0.44
55 0.42
56 0.4
57 0.36
58 0.28
59 0.23
60 0.15
61 0.11
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.06
69 0.07
70 0.09
71 0.09
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.1
85 0.14
86 0.18
87 0.21
88 0.28
89 0.33
90 0.37
91 0.38
92 0.41
93 0.42
94 0.41
95 0.41
96 0.39
97 0.36
98 0.34
99 0.41
100 0.43
101 0.46
102 0.47
103 0.53
104 0.55
105 0.6
106 0.67
107 0.69
108 0.73
109 0.74
110 0.78
111 0.8
112 0.83
113 0.85
114 0.84
115 0.85
116 0.85