Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N2I9

Protein Details
Accession G4N2I9   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-95LCPATRRRILHGRKGSRDKSRGBasic
NLS Segment(s)
PositionSequence
86-87RK
Subcellular Location(s) mito 18, nucl 4, plas 3, cyto_nucl 3
Family & Domain DBs
KEGG mgr:MGG_16662  -  
Amino Acid Sequences MWSPTLLQALMIGVTIGREFARSKPGTLSKTPIVTPSLLNVLAMGTVKTSLTIILTLTLIKSVKKSLSSNITSLCPATRRRILHGRKGSRDKSRGWVAIWSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.08
7 0.1
8 0.19
9 0.2
10 0.21
11 0.27
12 0.34
13 0.37
14 0.38
15 0.42
16 0.36
17 0.38
18 0.37
19 0.32
20 0.27
21 0.23
22 0.21
23 0.17
24 0.16
25 0.13
26 0.12
27 0.1
28 0.08
29 0.07
30 0.07
31 0.06
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.07
48 0.08
49 0.09
50 0.11
51 0.15
52 0.16
53 0.2
54 0.27
55 0.29
56 0.3
57 0.3
58 0.29
59 0.26
60 0.26
61 0.23
62 0.19
63 0.2
64 0.25
65 0.3
66 0.31
67 0.38
68 0.48
69 0.53
70 0.6
71 0.67
72 0.7
73 0.73
74 0.8
75 0.81
76 0.81
77 0.79
78 0.72
79 0.7
80 0.7
81 0.63
82 0.55