Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4NAZ3

Protein Details
Accession G4NAZ3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-79GQSSAPAKPKRSKSKKKSKKEAKPPPGKSRSGYBasic
NLS Segment(s)
PositionSequence
52-76PAKPKRSKSKKKSKKEAKPPPGKSR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG mgr:MGG_11524  -  
Amino Acid Sequences MSRHYSTQPLMAPEQGGYDYSGHDEYSQGYDESQGGYGEPSGSGGQGQSSAPAKPKRSKSKKKSKKEAKPPPGKSRSGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.15
4 0.12
5 0.1
6 0.1
7 0.11
8 0.12
9 0.1
10 0.1
11 0.1
12 0.1
13 0.11
14 0.12
15 0.1
16 0.09
17 0.1
18 0.1
19 0.1
20 0.09
21 0.07
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.07
36 0.08
37 0.09
38 0.16
39 0.21
40 0.27
41 0.34
42 0.44
43 0.53
44 0.64
45 0.74
46 0.78
47 0.85
48 0.9
49 0.93
50 0.95
51 0.95
52 0.95
53 0.95
54 0.95
55 0.95
56 0.95
57 0.94
58 0.93
59 0.9
60 0.84