Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4N1V1

Protein Details
Accession G4N1V1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-39GKGLRLKGAKVKKNKKKKTEGSKAADKVTBasic
NLS Segment(s)
PositionSequence
12-33KGLRLKGAKVKKNKKKKTEGSK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG mgr:MGG_09476  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGDDDYTVAGGKGLRLKGAKVKKNKKKKTEGSKAADKVTELDKALSADKRSDKDADAADGDDEQAPARQDEEYAPLRRKTETERRFEEAKRKKLLEMAQSAAAKPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.23
4 0.31
5 0.41
6 0.46
7 0.52
8 0.63
9 0.69
10 0.79
11 0.87
12 0.88
13 0.89
14 0.91
15 0.91
16 0.92
17 0.91
18 0.88
19 0.87
20 0.8
21 0.72
22 0.62
23 0.51
24 0.42
25 0.34
26 0.28
27 0.19
28 0.16
29 0.14
30 0.15
31 0.17
32 0.17
33 0.16
34 0.19
35 0.22
36 0.23
37 0.25
38 0.25
39 0.23
40 0.24
41 0.23
42 0.2
43 0.17
44 0.15
45 0.13
46 0.11
47 0.11
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.06
56 0.06
57 0.07
58 0.11
59 0.15
60 0.18
61 0.21
62 0.22
63 0.24
64 0.24
65 0.25
66 0.28
67 0.35
68 0.39
69 0.43
70 0.46
71 0.49
72 0.53
73 0.55
74 0.58
75 0.56
76 0.57
77 0.56
78 0.53
79 0.49
80 0.51
81 0.53
82 0.49
83 0.44
84 0.38
85 0.37
86 0.36
87 0.35
88 0.31
89 0.25
90 0.18
91 0.14
92 0.17
93 0.17
94 0.19
95 0.26
96 0.31
97 0.4
98 0.44
99 0.45
100 0.44
101 0.45
102 0.5
103 0.46
104 0.43
105 0.41
106 0.38
107 0.37
108 0.35
109 0.28
110 0.21
111 0.19
112 0.2
113 0.2
114 0.22
115 0.27
116 0.33
117 0.34