Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G5EHX3

Protein Details
Accession G5EHX3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-37GTPTKRPRPTKPPTPPPGPRPBasic
NLS Segment(s)
PositionSequence
21-61KRPRPTKPPTPPPGPRPGPLAPIPPGNPTPPPSPRRRASHK
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
KEGG mgr:MGG_18023  -  
Amino Acid Sequences MQHAELYCRAPTALGLGTPTKRPRPTKPPTPPPGPRPGPLAPIPPGNPTPPPSPRRRASHKHLPAQAVGLISHPATTFVNSGPPATSQKRQPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.18
5 0.24
6 0.29
7 0.33
8 0.4
9 0.46
10 0.52
11 0.59
12 0.66
13 0.71
14 0.76
15 0.79
16 0.79
17 0.82
18 0.8
19 0.76
20 0.77
21 0.69
22 0.6
23 0.55
24 0.49
25 0.44
26 0.39
27 0.36
28 0.28
29 0.27
30 0.26
31 0.23
32 0.23
33 0.19
34 0.19
35 0.19
36 0.22
37 0.27
38 0.32
39 0.36
40 0.42
41 0.48
42 0.54
43 0.59
44 0.63
45 0.64
46 0.7
47 0.72
48 0.72
49 0.71
50 0.65
51 0.57
52 0.51
53 0.43
54 0.33
55 0.24
56 0.17
57 0.13
58 0.11
59 0.11
60 0.09
61 0.09
62 0.09
63 0.1
64 0.11
65 0.1
66 0.15
67 0.15
68 0.16
69 0.16
70 0.18
71 0.24
72 0.29
73 0.34