Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MN17

Protein Details
Accession G4MN17   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKRKSSSKPPPKKKKDPLPTQFTCLHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKSSSKPPPKKKK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003746  F:translation elongation factor activity  
GO:0008270  F:zinc ion binding  
GO:0006325  P:chromatin organization  
GO:0006355  P:regulation of DNA-templated transcription  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG mgr:MGG_06916  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPPPKKKKDPLPTQFTCLFCNHEKSVDVKLDKKMGVGNLECKICGQRFQCGINYLSAAVDVYGEWVDAADAVAEQTSLENRGSGGSSSRAKPSSSRYEEEDRYAGHGVGADDDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.94
4 0.94
5 0.92
6 0.91
7 0.83
8 0.78
9 0.73
10 0.63
11 0.55
12 0.46
13 0.41
14 0.34
15 0.37
16 0.32
17 0.28
18 0.28
19 0.27
20 0.31
21 0.32
22 0.31
23 0.29
24 0.31
25 0.33
26 0.32
27 0.3
28 0.27
29 0.22
30 0.24
31 0.21
32 0.22
33 0.22
34 0.22
35 0.21
36 0.19
37 0.2
38 0.17
39 0.21
40 0.18
41 0.19
42 0.22
43 0.24
44 0.25
45 0.25
46 0.25
47 0.2
48 0.19
49 0.14
50 0.11
51 0.09
52 0.07
53 0.05
54 0.04
55 0.03
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.1
80 0.13
81 0.17
82 0.19
83 0.24
84 0.25
85 0.25
86 0.29
87 0.34
88 0.4
89 0.42
90 0.43
91 0.44
92 0.51
93 0.53
94 0.53
95 0.48
96 0.38
97 0.36
98 0.34
99 0.28
100 0.21
101 0.2
102 0.16
103 0.15