Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G5EGY7

Protein Details
Accession G5EGY7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-104QRQLRESKKRQEKAEKERQEBasic
NLS Segment(s)
PositionSequence
89-118RESKKRQEKAEKERQEERQRAEKAEKERQE
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
KEGG mgr:MGG_15032  -  
Amino Acid Sequences MVVGKIGRQCRALEACFLEAFGEVHQSRDGPGGNAYPAGREIFTFSYGSRPLVQSRGEDFRLLFEVRASVELLLRSRQVTPRNLQRQLRESKKRQEKAEKERQEERQRAEKAEKERQEERQRAEAAEKERQEERQRVEALEQQTQPTKLDEYIAACHFLVESVRNAFDLGNGIIFENYLYIISNLLKEVVYRDTPSTPPVIPNHNFNLNRLRPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.31
4 0.3
5 0.23
6 0.18
7 0.17
8 0.12
9 0.16
10 0.14
11 0.15
12 0.16
13 0.16
14 0.16
15 0.19
16 0.19
17 0.13
18 0.15
19 0.15
20 0.15
21 0.18
22 0.17
23 0.14
24 0.15
25 0.15
26 0.13
27 0.11
28 0.14
29 0.13
30 0.15
31 0.15
32 0.14
33 0.18
34 0.19
35 0.2
36 0.19
37 0.19
38 0.2
39 0.23
40 0.24
41 0.22
42 0.25
43 0.29
44 0.28
45 0.27
46 0.25
47 0.23
48 0.24
49 0.22
50 0.18
51 0.12
52 0.12
53 0.11
54 0.12
55 0.11
56 0.08
57 0.09
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.13
64 0.18
65 0.22
66 0.26
67 0.31
68 0.4
69 0.48
70 0.54
71 0.56
72 0.55
73 0.58
74 0.62
75 0.66
76 0.65
77 0.64
78 0.67
79 0.73
80 0.74
81 0.74
82 0.76
83 0.75
84 0.76
85 0.8
86 0.77
87 0.72
88 0.73
89 0.74
90 0.72
91 0.68
92 0.61
93 0.6
94 0.54
95 0.52
96 0.49
97 0.45
98 0.43
99 0.47
100 0.47
101 0.43
102 0.45
103 0.52
104 0.57
105 0.56
106 0.53
107 0.51
108 0.47
109 0.43
110 0.41
111 0.37
112 0.32
113 0.34
114 0.31
115 0.27
116 0.28
117 0.32
118 0.36
119 0.37
120 0.36
121 0.37
122 0.37
123 0.35
124 0.36
125 0.36
126 0.33
127 0.33
128 0.3
129 0.25
130 0.27
131 0.27
132 0.26
133 0.22
134 0.2
135 0.14
136 0.15
137 0.14
138 0.14
139 0.17
140 0.16
141 0.17
142 0.15
143 0.15
144 0.13
145 0.12
146 0.11
147 0.09
148 0.1
149 0.11
150 0.11
151 0.11
152 0.12
153 0.11
154 0.11
155 0.12
156 0.1
157 0.09
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.07
169 0.08
170 0.08
171 0.08
172 0.09
173 0.09
174 0.09
175 0.11
176 0.14
177 0.16
178 0.18
179 0.21
180 0.23
181 0.25
182 0.26
183 0.28
184 0.24
185 0.27
186 0.29
187 0.35
188 0.34
189 0.39
190 0.42
191 0.48
192 0.48
193 0.46
194 0.53