FuNGI

G4NCW4

Protein Details

Accession

G4NCW4

Localization Confidence

Low

Confidence Score

7.7

NoLS Segment(s)

Position	Sequence	Protein Nature
430-453	ESEGKEKTTRTRRVVPKGNNAAAT	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 15, nucl 9, cyto_mito 9

Family & Domain DBs

InterPro	View protein in InterPro IPR041723 CCT IPR004821 Cyt_trans-like IPR045049 Pcy1-like IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0042564 C:NLS-dependent protein nuclear import complex GO:0005635 C:nuclear envelope GO:0004105 F:choline-phosphate cytidylyltransferase activity
KEGG	mgr:MGG_01003 -
Pfam	View protein in Pfam PF01467 CTP_transf_like
CDD	cd02174 CCT

Amino Acid Sequences

MSSTTQAAANKRKRLTGGSTTSLPDEVAAAERAQISESRDASAEEGDTTAAETPATAPTSHPPIKRQRSSNNAVGDATVDLGEPSDTTEASVDIENRVGRKGRKSSNPEKEEESMAPPPIGKLTHPVGYRTNDPPVGRPVRIYADGVFDLFHLGHMRQLEQAKKAFPDVYLIVGVTGDAETHKRKGLTVLSGKERAETVRHCKWVDEVIENCPWIVTPEFLEEHKLDYVAHDDIPYGADEGDDIYGPIKAEGKFLVTQRTEGVSTTGIITKIVRDYEKYIARQLKRGTSRQELNVSWLKKNELDLKRHVQDLRENIRSNWTTTGQELSRELRQYWPASRPQSPAPSRPSLQVPNGDQLTSPQQQSSLREAQLRSPTTPGGANVNSNDFVAGYAVGLIGGVRSWMTKSRRSLRDERDDSSSRPPSDDSSEESEGKEKTTRTRRVVPKGNNAAATGA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.59
2	0.58
3	0.58
4	0.57
5	0.53
6	0.53
7	0.5
8	0.48
9	0.42
10	0.34
11	0.24
12	0.17
13	0.13
14	0.12
15	0.12
16	0.1
17	0.12
18	0.13
19	0.13
20	0.13
21	0.15
22	0.16
23	0.22
24	0.22
25	0.22
26	0.22
27	0.23
28	0.23
29	0.22
30	0.18
31	0.12
32	0.12
33	0.1
34	0.09
35	0.1
36	0.09
37	0.08
38	0.07
39	0.07
40	0.08
41	0.11
42	0.12
43	0.12
44	0.12
45	0.16
46	0.26
47	0.32
48	0.34
49	0.39
50	0.48
51	0.59
52	0.65
53	0.69
54	0.7
55	0.73
56	0.78
57	0.77
58	0.71
59	0.62
60	0.54
61	0.46
62	0.37
63	0.28
64	0.21
65	0.14
66	0.08
67	0.06
68	0.06
69	0.06
70	0.05
71	0.07
72	0.07
73	0.07
74	0.07
75	0.08
76	0.07
77	0.09
78	0.1
79	0.1
80	0.1
81	0.12
82	0.14
83	0.14
84	0.17
85	0.21
86	0.24
87	0.31
88	0.39
89	0.45
90	0.54
91	0.62
92	0.7
93	0.76
94	0.77
95	0.71
96	0.67
97	0.61
98	0.55
99	0.48
100	0.41
101	0.33
102	0.29
103	0.26
104	0.21
105	0.19
106	0.18
107	0.17
108	0.12
109	0.14
110	0.17
111	0.22
112	0.23
113	0.25
114	0.28
115	0.3
116	0.35
117	0.33
118	0.34
119	0.33
120	0.32
121	0.33
122	0.36
123	0.38
124	0.34
125	0.31
126	0.3
127	0.3
128	0.3
129	0.29
130	0.21
131	0.2
132	0.19
133	0.18
134	0.16
135	0.12
136	0.11
137	0.09
138	0.09
139	0.07
140	0.07
141	0.09
142	0.1
143	0.1
144	0.14
145	0.18
146	0.2
147	0.23
148	0.25
149	0.25
150	0.25
151	0.26
152	0.23
153	0.19
154	0.19
155	0.16
156	0.15
157	0.13
158	0.12
159	0.1
160	0.09
161	0.09
162	0.05
163	0.05
164	0.03
165	0.04
166	0.07
167	0.09
168	0.1
169	0.13
170	0.12
171	0.13
172	0.17
173	0.19
174	0.24
175	0.28
176	0.31
177	0.33
178	0.37
179	0.36
180	0.33
181	0.31
182	0.24
183	0.22
184	0.22
185	0.25
186	0.28
187	0.32
188	0.31
189	0.31
190	0.31
191	0.32
192	0.3
193	0.27
194	0.22
195	0.22
196	0.23
197	0.22
198	0.2
199	0.15
200	0.13
201	0.1
202	0.09
203	0.07
204	0.06
205	0.08
206	0.09
207	0.1
208	0.12
209	0.11
210	0.12
211	0.12
212	0.11
213	0.09
214	0.09
215	0.11
216	0.09
217	0.09
218	0.07
219	0.07
220	0.07
221	0.08
222	0.08
223	0.06
224	0.05
225	0.04
226	0.04
227	0.05
228	0.05
229	0.04
230	0.04
231	0.04
232	0.04
233	0.05
234	0.05
235	0.08
236	0.08
237	0.09
238	0.09
239	0.12
240	0.14
241	0.15
242	0.21
243	0.18
244	0.18
245	0.19
246	0.2
247	0.18
248	0.15
249	0.16
250	0.09
251	0.09
252	0.1
253	0.1
254	0.09
255	0.09
256	0.09
257	0.09
258	0.1
259	0.12
260	0.11
261	0.11
262	0.15
263	0.21
264	0.26
265	0.26
266	0.31
267	0.38
268	0.38
269	0.43
270	0.43
271	0.44
272	0.46
273	0.5
274	0.49
275	0.49
276	0.51
277	0.5
278	0.52
279	0.44
280	0.43
281	0.44
282	0.41
283	0.35
284	0.33
285	0.3
286	0.26
287	0.3
288	0.34
289	0.34
290	0.36
291	0.41
292	0.47
293	0.47
294	0.5
295	0.48
296	0.41
297	0.4
298	0.45
299	0.46
300	0.45
301	0.44
302	0.4
303	0.47
304	0.45
305	0.41
306	0.35
307	0.3
308	0.25
309	0.24
310	0.29
311	0.21
312	0.22
313	0.22
314	0.22
315	0.24
316	0.25
317	0.25
318	0.24
319	0.28
320	0.3
321	0.33
322	0.35
323	0.38
324	0.41
325	0.45
326	0.44
327	0.45
328	0.52
329	0.52
330	0.53
331	0.52
332	0.53
333	0.5
334	0.5
335	0.5
336	0.46
337	0.45
338	0.45
339	0.41
340	0.41
341	0.4
342	0.37
343	0.31
344	0.28
345	0.31
346	0.28
347	0.26
348	0.2
349	0.22
350	0.24
351	0.29
352	0.33
353	0.32
354	0.31
355	0.36
356	0.37
357	0.41
358	0.46
359	0.45
360	0.4
361	0.36
362	0.34
363	0.31
364	0.31
365	0.26
366	0.23
367	0.22
368	0.23
369	0.22
370	0.25
371	0.23
372	0.22
373	0.2
374	0.14
375	0.13
376	0.11
377	0.09
378	0.06
379	0.05
380	0.05
381	0.05
382	0.04
383	0.04
384	0.03
385	0.03
386	0.03
387	0.04
388	0.05
389	0.07
390	0.15
391	0.2
392	0.27
393	0.37
394	0.47
395	0.55
396	0.62
397	0.71
398	0.73
399	0.79
400	0.77
401	0.71
402	0.69
403	0.65
404	0.61
405	0.6
406	0.58
407	0.48
408	0.45
409	0.44
410	0.4
411	0.42
412	0.41
413	0.37
414	0.36
415	0.39
416	0.38
417	0.38
418	0.38
419	0.32
420	0.32
421	0.32
422	0.27
423	0.33
424	0.42
425	0.51
426	0.54
427	0.64
428	0.71
429	0.77
430	0.85
431	0.84
432	0.84
433	0.85
434	0.83
435	0.74

G4NCW4

3D AlphaFold-predicted Structure Viewer