Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MXQ2

Protein Details
Accession G4MXQ2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22PTPVKPKPVKVSPTPIKRKAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
KEGG mgr:MGG_08044  -  
Amino Acid Sequences MPTPVKPKPVKVSPTPIKRKAEELQDTTIYFDQKGDLRFMVGAEERVFVVCSRTVSRASVVFERMLYGPFAEKKPDDTDSDWVVKLPEDSSKGLEVIFNVVHARFKLVTDFLGLDDLFDVMVMADKYDTMEPIQPWCRRWAENAKRIYSCGTERGQELMILWTAWKLGSSALYEQAAVRLLPRISRPPSTSRSPTTVDIKSYLVGEQRMSEMDGFKYAGSASIIQPVLRVREIVLQRMIDAVNLGKRELMNEKKTSPCQVRYQENGPKNKRQACKTMLAGSICLNQAAWSKVPTFAKDVCHSVESFQHEIDSVLDTLMTLTGHNRCSPKEMIVDDVKKASVLETTSIFIDRKLYRCLVSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.81
4 0.8
5 0.74
6 0.74
7 0.69
8 0.7
9 0.67
10 0.62
11 0.58
12 0.54
13 0.52
14 0.48
15 0.44
16 0.35
17 0.27
18 0.22
19 0.2
20 0.21
21 0.22
22 0.22
23 0.19
24 0.19
25 0.19
26 0.19
27 0.2
28 0.17
29 0.18
30 0.16
31 0.16
32 0.15
33 0.15
34 0.16
35 0.12
36 0.13
37 0.13
38 0.14
39 0.17
40 0.19
41 0.2
42 0.21
43 0.23
44 0.24
45 0.26
46 0.27
47 0.26
48 0.25
49 0.23
50 0.23
51 0.22
52 0.19
53 0.16
54 0.13
55 0.15
56 0.18
57 0.19
58 0.22
59 0.21
60 0.24
61 0.28
62 0.3
63 0.3
64 0.29
65 0.32
66 0.32
67 0.35
68 0.31
69 0.27
70 0.24
71 0.21
72 0.19
73 0.15
74 0.15
75 0.15
76 0.16
77 0.18
78 0.18
79 0.18
80 0.17
81 0.16
82 0.13
83 0.12
84 0.11
85 0.1
86 0.1
87 0.1
88 0.11
89 0.11
90 0.13
91 0.11
92 0.11
93 0.13
94 0.13
95 0.13
96 0.13
97 0.13
98 0.11
99 0.12
100 0.11
101 0.09
102 0.08
103 0.08
104 0.06
105 0.05
106 0.05
107 0.03
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.1
118 0.11
119 0.16
120 0.24
121 0.25
122 0.26
123 0.31
124 0.33
125 0.31
126 0.37
127 0.43
128 0.45
129 0.5
130 0.55
131 0.54
132 0.51
133 0.51
134 0.47
135 0.38
136 0.3
137 0.27
138 0.23
139 0.2
140 0.2
141 0.21
142 0.19
143 0.16
144 0.15
145 0.11
146 0.09
147 0.08
148 0.07
149 0.06
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.05
156 0.07
157 0.07
158 0.09
159 0.09
160 0.09
161 0.09
162 0.09
163 0.08
164 0.07
165 0.06
166 0.07
167 0.07
168 0.09
169 0.11
170 0.16
171 0.18
172 0.22
173 0.24
174 0.27
175 0.32
176 0.36
177 0.39
178 0.36
179 0.37
180 0.37
181 0.37
182 0.37
183 0.34
184 0.29
185 0.26
186 0.24
187 0.21
188 0.18
189 0.16
190 0.13
191 0.12
192 0.11
193 0.1
194 0.1
195 0.1
196 0.1
197 0.09
198 0.09
199 0.08
200 0.09
201 0.09
202 0.08
203 0.08
204 0.07
205 0.07
206 0.07
207 0.08
208 0.08
209 0.12
210 0.13
211 0.12
212 0.13
213 0.14
214 0.15
215 0.14
216 0.14
217 0.1
218 0.17
219 0.18
220 0.2
221 0.21
222 0.19
223 0.19
224 0.2
225 0.19
226 0.12
227 0.11
228 0.1
229 0.1
230 0.11
231 0.11
232 0.11
233 0.11
234 0.13
235 0.2
236 0.26
237 0.29
238 0.32
239 0.36
240 0.4
241 0.43
242 0.48
243 0.47
244 0.45
245 0.47
246 0.51
247 0.55
248 0.54
249 0.6
250 0.61
251 0.62
252 0.67
253 0.65
254 0.67
255 0.69
256 0.72
257 0.71
258 0.67
259 0.69
260 0.64
261 0.64
262 0.59
263 0.56
264 0.52
265 0.46
266 0.41
267 0.34
268 0.32
269 0.26
270 0.22
271 0.16
272 0.13
273 0.15
274 0.16
275 0.16
276 0.14
277 0.15
278 0.21
279 0.23
280 0.24
281 0.26
282 0.26
283 0.31
284 0.32
285 0.34
286 0.31
287 0.31
288 0.3
289 0.27
290 0.29
291 0.29
292 0.27
293 0.24
294 0.22
295 0.2
296 0.2
297 0.2
298 0.17
299 0.11
300 0.09
301 0.09
302 0.08
303 0.08
304 0.08
305 0.08
306 0.06
307 0.09
308 0.13
309 0.16
310 0.21
311 0.24
312 0.24
313 0.3
314 0.32
315 0.32
316 0.34
317 0.33
318 0.35
319 0.42
320 0.43
321 0.4
322 0.4
323 0.36
324 0.3
325 0.29
326 0.23
327 0.17
328 0.15
329 0.15
330 0.15
331 0.16
332 0.17
333 0.2
334 0.19
335 0.17
336 0.22
337 0.25
338 0.27
339 0.32
340 0.34
341 0.33