Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NC57

Protein Details
Accession G4NC57    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
180-204GVGKSTSSKGQKKAKKIKLSFGDDGHydrophilic
NLS Segment(s)
PositionSequence
114-117RKRK
189-195GQKKAKK
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG mgr:MGG_01136  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKITGKNLSYSQNLPPFLARLQGQGRGPADGPDPILAGRRRAARPRDDGEDAPVVLDEQGNVVDDVRVGVDGSAVRTAFGCGDDEGAGEEGDKNAGEGAVDGAKREVGIGARKRKVAPGKVIGGADEDDEDDGSVDEVPGKKMGKGGKSKAAVTDHDAGGETTQAVAASKKASATSTGVGKSTSSKGQKKAKKIKLSFGDDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.39
4 0.35
5 0.33
6 0.29
7 0.31
8 0.23
9 0.23
10 0.25
11 0.29
12 0.29
13 0.32
14 0.33
15 0.3
16 0.3
17 0.25
18 0.24
19 0.2
20 0.2
21 0.14
22 0.14
23 0.12
24 0.18
25 0.18
26 0.19
27 0.22
28 0.28
29 0.32
30 0.4
31 0.47
32 0.48
33 0.54
34 0.56
35 0.58
36 0.55
37 0.5
38 0.46
39 0.41
40 0.34
41 0.26
42 0.22
43 0.16
44 0.11
45 0.11
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.07
72 0.07
73 0.06
74 0.07
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.05
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.12
98 0.19
99 0.27
100 0.3
101 0.32
102 0.32
103 0.37
104 0.43
105 0.41
106 0.41
107 0.38
108 0.39
109 0.39
110 0.39
111 0.33
112 0.27
113 0.22
114 0.16
115 0.11
116 0.08
117 0.06
118 0.06
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.06
126 0.07
127 0.08
128 0.11
129 0.11
130 0.12
131 0.15
132 0.2
133 0.25
134 0.32
135 0.36
136 0.41
137 0.43
138 0.44
139 0.45
140 0.44
141 0.38
142 0.36
143 0.36
144 0.27
145 0.25
146 0.25
147 0.2
148 0.17
149 0.15
150 0.1
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.07
157 0.08
158 0.09
159 0.1
160 0.1
161 0.11
162 0.14
163 0.16
164 0.18
165 0.21
166 0.22
167 0.22
168 0.21
169 0.21
170 0.22
171 0.23
172 0.28
173 0.33
174 0.39
175 0.47
176 0.57
177 0.64
178 0.72
179 0.79
180 0.81
181 0.83
182 0.81
183 0.83
184 0.82
185 0.82