Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NGI9

Protein Details
Accession G4NGI9   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
256-289TDWVEAMKQKSRRHRGKPCAKVPTKCRKKMKRCRBasic
NLS Segment(s)
PositionSequence
264-289QKSRRHRGKPCAKVPTKCRKKMKRCR
Subcellular Location(s) cyto 14, nucl 6, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR003960  ATPase_AAA_CS  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
KEGG mgr:MGG_14893  -  
Pfam View protein in Pfam  
PF00004  AAA  
PROSITE View protein in PROSITE  
PS00674  AAA  
Amino Acid Sequences MMFGRLGDDVEKMTDALLVAWNICGPAQVHDPNKIYLDPKSEEWYANHGIPLRRGYLFHGPPGTGKTSLSLALADFFGLDIYVINLAEPALTDNSLLELANDVPERCIVLLENIDTVGLKRFEVKKLKQIRESSGRLAKRNGVTIGGVLNAFDGAASQEGRVLILATNKPASLDEALIRPGRVDLKLCFDNITKNHARDLFWRMYTPDTSAETNELVKLAAEFGCKISEKIFSPAEVPNYLIMHKDQPRQALSGVTDWVEAMKQKSRRHRGKPCAKVPTKCRKKMKRCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.11
5 0.1
6 0.09
7 0.1
8 0.1
9 0.09
10 0.09
11 0.1
12 0.08
13 0.11
14 0.17
15 0.24
16 0.26
17 0.33
18 0.35
19 0.36
20 0.37
21 0.36
22 0.32
23 0.29
24 0.32
25 0.29
26 0.29
27 0.32
28 0.32
29 0.32
30 0.32
31 0.34
32 0.32
33 0.3
34 0.29
35 0.29
36 0.29
37 0.3
38 0.31
39 0.28
40 0.25
41 0.25
42 0.28
43 0.33
44 0.32
45 0.33
46 0.32
47 0.29
48 0.3
49 0.33
50 0.31
51 0.21
52 0.2
53 0.17
54 0.16
55 0.17
56 0.15
57 0.12
58 0.09
59 0.1
60 0.09
61 0.08
62 0.06
63 0.05
64 0.05
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.05
85 0.05
86 0.06
87 0.08
88 0.09
89 0.08
90 0.08
91 0.08
92 0.09
93 0.08
94 0.08
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.08
106 0.07
107 0.13
108 0.15
109 0.22
110 0.3
111 0.32
112 0.38
113 0.48
114 0.53
115 0.55
116 0.56
117 0.56
118 0.55
119 0.56
120 0.52
121 0.5
122 0.48
123 0.43
124 0.41
125 0.39
126 0.33
127 0.32
128 0.27
129 0.2
130 0.17
131 0.15
132 0.14
133 0.1
134 0.08
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.02
142 0.03
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.09
152 0.09
153 0.1
154 0.11
155 0.1
156 0.11
157 0.11
158 0.12
159 0.09
160 0.09
161 0.09
162 0.1
163 0.12
164 0.13
165 0.12
166 0.11
167 0.11
168 0.12
169 0.12
170 0.13
171 0.12
172 0.18
173 0.19
174 0.19
175 0.2
176 0.19
177 0.24
178 0.23
179 0.29
180 0.28
181 0.28
182 0.31
183 0.32
184 0.32
185 0.3
186 0.36
187 0.33
188 0.29
189 0.3
190 0.27
191 0.28
192 0.27
193 0.25
194 0.21
195 0.19
196 0.19
197 0.19
198 0.19
199 0.17
200 0.17
201 0.15
202 0.12
203 0.1
204 0.09
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.09
211 0.12
212 0.12
213 0.13
214 0.13
215 0.16
216 0.17
217 0.21
218 0.21
219 0.19
220 0.21
221 0.24
222 0.26
223 0.23
224 0.22
225 0.2
226 0.2
227 0.19
228 0.18
229 0.17
230 0.22
231 0.27
232 0.33
233 0.34
234 0.39
235 0.4
236 0.41
237 0.4
238 0.35
239 0.31
240 0.27
241 0.25
242 0.2
243 0.18
244 0.15
245 0.15
246 0.13
247 0.13
248 0.15
249 0.21
250 0.28
251 0.36
252 0.47
253 0.58
254 0.67
255 0.75
256 0.83
257 0.86
258 0.9
259 0.93
260 0.92
261 0.92
262 0.9
263 0.89
264 0.88
265 0.88
266 0.88
267 0.87
268 0.89
269 0.89