Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N689

Protein Details
Accession G4N689   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-122ASAPSLRRRHWRCKSVTSSRSLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 5, mito 4, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_14862  -  
Amino Acid Sequences MSMTYLVLVAAVNLWAFRVVPLDTFLTKSSVGGWRDFVSFNIDSLDTVYLFIAFESIVHLGEETRNPKRAVPTGMFWGYVANAVMGFMIAMLDFNDSAFIASAPSLRRRHWRCKSVTSSRSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.08
6 0.08
7 0.08
8 0.11
9 0.13
10 0.14
11 0.15
12 0.16
13 0.16
14 0.15
15 0.15
16 0.16
17 0.19
18 0.2
19 0.19
20 0.21
21 0.2
22 0.21
23 0.22
24 0.19
25 0.18
26 0.17
27 0.16
28 0.15
29 0.14
30 0.12
31 0.13
32 0.13
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.04
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.08
50 0.12
51 0.14
52 0.18
53 0.19
54 0.2
55 0.24
56 0.27
57 0.28
58 0.26
59 0.26
60 0.28
61 0.28
62 0.26
63 0.23
64 0.19
65 0.15
66 0.13
67 0.11
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.09
90 0.11
91 0.19
92 0.22
93 0.26
94 0.37
95 0.44
96 0.55
97 0.63
98 0.69
99 0.69
100 0.76
101 0.83
102 0.83
103 0.82