Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4N0W2

Protein Details
Accession G4N0W2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
14-34KLDRVERKEVKQEKRRQLSKIBasic
NLS Segment(s)
Subcellular Location(s) mito 9.5, cyto_mito 6, plas 5, pero 5, nucl 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_16782  -  
Amino Acid Sequences IMRVIFRGINDLEKLDRVERKEVKQEKRRQLSKILSKILFKLFFPDSNFIWDSSFPINLLNPFLLNKINIFAQYLIGRFFICLFWFVIYINCPISGNIGGMVPGNFGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.27
4 0.27
5 0.36
6 0.4
7 0.43
8 0.52
9 0.59
10 0.64
11 0.69
12 0.76
13 0.77
14 0.82
15 0.82
16 0.75
17 0.75
18 0.74
19 0.74
20 0.71
21 0.67
22 0.59
23 0.55
24 0.54
25 0.5
26 0.41
27 0.31
28 0.28
29 0.23
30 0.23
31 0.25
32 0.24
33 0.2
34 0.22
35 0.23
36 0.19
37 0.18
38 0.15
39 0.15
40 0.13
41 0.13
42 0.09
43 0.08
44 0.09
45 0.08
46 0.09
47 0.07
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.1
60 0.11
61 0.11
62 0.11
63 0.11
64 0.1
65 0.09
66 0.1
67 0.09
68 0.08
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.11
76 0.12
77 0.12
78 0.12
79 0.12
80 0.11
81 0.14
82 0.14
83 0.13
84 0.11
85 0.11
86 0.1
87 0.11
88 0.11
89 0.08