Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75AS2

Protein Details
Accession Q75AS2   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
290-310QYYTHRGLKKKRKIYVGKFEFHydrophilic
342-368QTSWRRDPAVNKRFHRRKVLCKAIERGHydrophilic
NLS Segment(s)
PositionSequence
174-212PKRNGGKKHPKGSVEHKFIISNGLKVPRRAVDPPAKRRR
299-300KK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0060963  P:positive regulation of ribosomal protein gene transcription by RNA polymerase II  
KEGG ago:AGOS_ADL152W  -  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MDIQANMELGGLERRVLDLERQISMYERLFQTFSAKLDHHFKKYDLVINAQQQQINVLTDIVSTMLNDQYRYAGILRDKLRGSLDGIVTTSTSIRGMQPNGGMPEQEPKPHDDDAVHAAHRANHHHAAADDGNRDLTNVDAILGEFIPPQVSPDENELHAAPAAPVPDAQTPAPKRNGGKKHPKGSVEHKFIISNGLKVPRRAVDPPAKRRREDPQKEYEFRDAEFSALASDGHPLDAQSAPPAPQHHDYDHDDRALPLQRADRPLSTGASPDPSAPSSSRLNSNIKEEQYYTHRGLKKKRKIYVGKFEFLNSPQTVLDIWKEYTEGFNGQPSLKDMETMYQTSWRRDPAVNKRFHRRKVLCKAIERGLERGYDLQDVVRVLEDSRLIDASRNLKQPIGWLCQGVNIPDLFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.17
5 0.21
6 0.24
7 0.25
8 0.26
9 0.26
10 0.27
11 0.29
12 0.27
13 0.26
14 0.24
15 0.25
16 0.25
17 0.25
18 0.26
19 0.26
20 0.25
21 0.24
22 0.23
23 0.25
24 0.35
25 0.41
26 0.42
27 0.43
28 0.42
29 0.44
30 0.48
31 0.51
32 0.44
33 0.44
34 0.45
35 0.48
36 0.53
37 0.49
38 0.45
39 0.38
40 0.37
41 0.33
42 0.27
43 0.21
44 0.15
45 0.12
46 0.11
47 0.11
48 0.09
49 0.07
50 0.06
51 0.07
52 0.11
53 0.12
54 0.12
55 0.12
56 0.13
57 0.13
58 0.15
59 0.14
60 0.15
61 0.17
62 0.24
63 0.26
64 0.31
65 0.31
66 0.31
67 0.32
68 0.29
69 0.29
70 0.26
71 0.25
72 0.2
73 0.2
74 0.18
75 0.16
76 0.15
77 0.13
78 0.08
79 0.08
80 0.08
81 0.11
82 0.15
83 0.16
84 0.18
85 0.19
86 0.22
87 0.25
88 0.24
89 0.21
90 0.18
91 0.23
92 0.22
93 0.25
94 0.23
95 0.23
96 0.26
97 0.27
98 0.27
99 0.2
100 0.22
101 0.23
102 0.24
103 0.21
104 0.19
105 0.19
106 0.21
107 0.23
108 0.24
109 0.25
110 0.25
111 0.25
112 0.25
113 0.24
114 0.26
115 0.26
116 0.24
117 0.2
118 0.16
119 0.17
120 0.16
121 0.16
122 0.11
123 0.09
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.08
140 0.11
141 0.13
142 0.13
143 0.14
144 0.13
145 0.13
146 0.12
147 0.11
148 0.08
149 0.07
150 0.08
151 0.06
152 0.06
153 0.08
154 0.09
155 0.11
156 0.11
157 0.17
158 0.19
159 0.24
160 0.27
161 0.29
162 0.31
163 0.39
164 0.47
165 0.5
166 0.58
167 0.62
168 0.67
169 0.69
170 0.69
171 0.64
172 0.65
173 0.65
174 0.6
175 0.53
176 0.46
177 0.41
178 0.38
179 0.4
180 0.31
181 0.22
182 0.18
183 0.23
184 0.24
185 0.24
186 0.26
187 0.21
188 0.23
189 0.24
190 0.28
191 0.3
192 0.38
193 0.49
194 0.57
195 0.59
196 0.57
197 0.58
198 0.62
199 0.64
200 0.64
201 0.6
202 0.6
203 0.64
204 0.66
205 0.66
206 0.61
207 0.5
208 0.41
209 0.38
210 0.28
211 0.2
212 0.17
213 0.14
214 0.09
215 0.08
216 0.08
217 0.05
218 0.06
219 0.05
220 0.06
221 0.06
222 0.05
223 0.07
224 0.07
225 0.07
226 0.07
227 0.08
228 0.09
229 0.11
230 0.12
231 0.14
232 0.18
233 0.2
234 0.2
235 0.25
236 0.29
237 0.32
238 0.33
239 0.3
240 0.26
241 0.24
242 0.27
243 0.26
244 0.21
245 0.19
246 0.21
247 0.23
248 0.27
249 0.3
250 0.26
251 0.25
252 0.26
253 0.25
254 0.21
255 0.19
256 0.15
257 0.16
258 0.16
259 0.14
260 0.14
261 0.13
262 0.15
263 0.14
264 0.17
265 0.18
266 0.2
267 0.23
268 0.26
269 0.31
270 0.3
271 0.36
272 0.38
273 0.36
274 0.36
275 0.32
276 0.31
277 0.31
278 0.35
279 0.32
280 0.34
281 0.38
282 0.43
283 0.53
284 0.6
285 0.65
286 0.69
287 0.72
288 0.74
289 0.8
290 0.83
291 0.84
292 0.8
293 0.74
294 0.66
295 0.6
296 0.53
297 0.44
298 0.41
299 0.29
300 0.24
301 0.2
302 0.19
303 0.18
304 0.16
305 0.17
306 0.14
307 0.14
308 0.13
309 0.14
310 0.13
311 0.14
312 0.15
313 0.15
314 0.13
315 0.15
316 0.17
317 0.17
318 0.17
319 0.19
320 0.21
321 0.18
322 0.19
323 0.16
324 0.19
325 0.21
326 0.22
327 0.2
328 0.24
329 0.27
330 0.3
331 0.33
332 0.32
333 0.33
334 0.36
335 0.45
336 0.49
337 0.56
338 0.61
339 0.64
340 0.72
341 0.78
342 0.8
343 0.81
344 0.79
345 0.8
346 0.82
347 0.86
348 0.83
349 0.81
350 0.8
351 0.76
352 0.75
353 0.66
354 0.59
355 0.5
356 0.43
357 0.37
358 0.34
359 0.29
360 0.23
361 0.21
362 0.18
363 0.18
364 0.17
365 0.16
366 0.14
367 0.13
368 0.12
369 0.14
370 0.15
371 0.13
372 0.15
373 0.16
374 0.15
375 0.17
376 0.22
377 0.26
378 0.31
379 0.36
380 0.35
381 0.36
382 0.36
383 0.4
384 0.42
385 0.42
386 0.38
387 0.34
388 0.33
389 0.36
390 0.38
391 0.32
392 0.28