Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MTT4

Protein Details
Accession G4MTT4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
117-136ITGKRKARSHLPEERPPRRABasic
NLS Segment(s)
PositionSequence
120-136KRKARSHLPEERPPRRA
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
KEGG mgr:MGG_15571  -  
Amino Acid Sequences MRRDTLRQALGQTRSLMMRVPAQIASTLLQLPPRDPPPTETIELCRRVPDLVGDWNTQAAALHSSEHRLEVTEEKLRRMTSLAQAERDKAASLELMVKDLENKTDDVARIQDALNLITGKRKARSHLPEERPPRRARFDEAGGNGSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.26
4 0.2
5 0.21
6 0.19
7 0.2
8 0.19
9 0.18
10 0.18
11 0.18
12 0.17
13 0.13
14 0.13
15 0.11
16 0.14
17 0.14
18 0.15
19 0.19
20 0.21
21 0.23
22 0.23
23 0.26
24 0.27
25 0.32
26 0.32
27 0.28
28 0.31
29 0.35
30 0.38
31 0.34
32 0.31
33 0.27
34 0.25
35 0.24
36 0.2
37 0.15
38 0.17
39 0.2
40 0.19
41 0.19
42 0.18
43 0.18
44 0.16
45 0.13
46 0.08
47 0.06
48 0.06
49 0.07
50 0.07
51 0.09
52 0.09
53 0.09
54 0.09
55 0.08
56 0.09
57 0.1
58 0.13
59 0.17
60 0.18
61 0.19
62 0.2
63 0.2
64 0.19
65 0.18
66 0.18
67 0.18
68 0.26
69 0.26
70 0.28
71 0.29
72 0.3
73 0.29
74 0.27
75 0.21
76 0.13
77 0.12
78 0.07
79 0.07
80 0.1
81 0.09
82 0.1
83 0.1
84 0.1
85 0.12
86 0.12
87 0.13
88 0.1
89 0.11
90 0.11
91 0.14
92 0.14
93 0.13
94 0.15
95 0.14
96 0.14
97 0.14
98 0.14
99 0.12
100 0.12
101 0.12
102 0.12
103 0.11
104 0.15
105 0.19
106 0.21
107 0.26
108 0.28
109 0.31
110 0.41
111 0.49
112 0.53
113 0.6
114 0.65
115 0.69
116 0.77
117 0.8
118 0.78
119 0.76
120 0.74
121 0.72
122 0.68
123 0.66
124 0.63
125 0.6
126 0.61
127 0.58
128 0.53